Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   BC_RS19075 Genome accession   NC_004722
Coordinates   3803957..3804736 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus ATCC 14579     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3778665..3840424 3803957..3804736 within 0


Gene organization within MGE regions


Location: 3778665..3840424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BC_RS18965 (BC3804) - 3779235..3780134 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  BC_RS18970 (BC3805) pnp 3780286..3782424 (-) 2139 WP_000076736.1 polyribonucleotide nucleotidyltransferase -
  BC_RS18975 (BC3806) rpsO 3782585..3782854 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BC_RS18980 (BC3807) ribF 3782955..3783926 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  BC_RS18985 (BC3808) truB 3783970..3784893 (-) 924 Protein_3767 tRNA pseudouridine(55) synthase TruB -
  BC_RS18990 (BC3809) rbfA 3784980..3785336 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  BC_RS18995 (BC3810) - 3785352..3785633 (-) 282 WP_000582363.1 DUF503 domain-containing protein -
  BC_RS19000 (BC3811) infB 3785630..3787690 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  BC_RS19005 (BC3812) - 3787695..3788006 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BC_RS19010 (BC3813) - 3788007..3788279 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  BC_RS19015 (BC3814) nusA 3788291..3789397 (-) 1107 WP_000102602.1 transcription termination factor NusA -
  BC_RS19020 (BC3815) rimP 3789415..3789885 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  BC_RS19025 (BC3816) - 3790222..3794523 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  BC_RS19030 (BC3817) - 3794648..3796348 (-) 1701 WP_000814303.1 proline--tRNA ligase -
  BC_RS19035 (BC3818) rseP 3796458..3797713 (-) 1256 Protein_3777 RIP metalloprotease RseP -
  BC_RS19040 (BC3819) dxr 3797731..3798873 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BC_RS19045 (BC3820) cdsA 3798897..3799688 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  BC_RS19050 (BC3821) uppS 3799706..3800482 (-) 777 WP_000971296.1 isoprenyl transferase -
  BC_RS19055 (BC3822) frr 3800568..3801125 (-) 558 WP_000531501.1 ribosome recycling factor -
  BC_RS19060 (BC3823) pyrH 3801128..3801850 (-) 723 WP_000042668.1 UMP kinase -
  BC_RS19065 (BC3824) tsf 3801917..3802804 (-) 888 WP_001018578.1 translation elongation factor Ts -
  BC_RS19070 (BC3825) rpsB 3802908..3803609 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  BC_RS19075 (BC3826) codY 3803957..3804736 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BC_RS19080 (BC3827) hslU 3804814..3806205 (-) 1392 WP_000550077.1 ATP-dependent protease ATPase subunit HslU -
  BC_RS19085 (BC3828) hslV 3806228..3806770 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BC_RS19090 (BC3829) xerC 3806813..3807712 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  BC_RS19095 (BC3830) trmFO 3807778..3809082 (-) 1305 WP_000213003.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BC_RS19100 (BC3831) topA 3809131..3811210 (-) 2080 Protein_3790 type I DNA topoisomerase -
  BC_RS19105 (BC3832) dprA 3811355..3812224 (-) 870 WP_000818060.1 DNA-processing protein DprA -
  BC_RS19110 (BC3833) sucD 3812313..3813215 (-) 903 WP_000115177.1 succinate--CoA ligase subunit alpha -
  BC_RS19115 (BC3834) sucC 3813235..3814395 (-) 1161 WP_001020783.1 ADP-forming succinate--CoA ligase subunit beta -
  BC_RS19120 (BC3835) - 3814590..3815363 (-) 774 WP_001194268.1 ribonuclease HII -
  BC_RS19125 (BC3836) ylqF 3815420..3816310 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  BC_RS19130 (BC3837) lepB 3816331..3816882 (-) 552 WP_000711853.1 signal peptidase I -
  BC_RS19135 (BC3838) rplS 3816984..3817328 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  BC_RS19140 (BC3839) trmD 3817475..3818209 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BC_RS19145 (BC3840) rimM 3818209..3818724 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  BC_RS19150 (BC3841) - 3818846..3819073 (-) 228 WP_000737401.1 KH domain-containing protein -
  BC_RS19155 (BC3842) rpsP 3819088..3819360 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BC_RS19160 (BC3843) ffh 3819462..3820811 (-) 1350 WP_000863460.1 signal recognition particle protein -
  BC_RS19165 (BC3844) - 3820824..3821156 (-) 333 WP_000891062.1 putative DNA-binding protein -
  BC_RS19170 (BC3845) ftsY 3821290..3822279 (-) 990 WP_000007656.1 signal recognition particle-docking protein FtsY -
  BC_RS19175 (BC3846) smc 3822295..3825864 (-) 3570 WP_000478972.1 chromosome segregation protein SMC -
  BC_RS19180 (BC3847) rncS 3826011..3826748 (-) 738 WP_001146875.1 ribonuclease III -
  BC_RS19185 (BC3848) acpP 3826807..3827040 (-) 234 WP_000786062.1 acyl carrier protein -
  BC_RS19190 (BC3849) fabG 3827110..3827850 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BC_RS19195 (BC3850) fabD 3827850..3828794 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  BC_RS19200 (BC3851) plsX 3828809..3829801 (-) 993 WP_000684092.1 phosphate acyltransferase PlsX -
  BC_RS19205 (BC3852) fapR 3829798..3830391 (-) 594 WP_000747348.1 transcription factor FapR -
  BC_RS19210 (BC3853) recG 3830480..3832528 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  BC_RS19215 (BC3854) - 3832819..3834495 (-) 1677 WP_000027130.1 DAK2 domain-containing protein -
  BC_RS19220 (BC3855) - 3834518..3834880 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BC_RS19225 (BC3856) rpmB 3835257..3835445 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  BC_RS19230 spoVM 3835519..3835599 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BC_RS19235 (BC3857) - 3835666..3836347 (-) 682 Protein_3817 thiamine diphosphokinase -
  BC_RS19240 (BC3858) rpe 3836416..3837060 (-) 645 WP_000589959.1 ribulose-phosphate 3-epimerase -
  BC_RS19245 (BC3859) rsgA 3837063..3837944 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  BC_RS19250 (BC3860) pknB 3838191..3840164 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=22929 BC_RS19075 WP_000421290.1 3803957..3804736(-) (codY) [Bacillus cereus ATCC 14579]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=22929 BC_RS19075 WP_000421290.1 3803957..3804736(-) (codY) [Bacillus cereus ATCC 14579]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment