Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BAJT_RS11710 Genome accession   NZ_CP020375
Coordinates   2441159..2441425 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain JTYP2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2436159..2446425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJT_RS11660 (BAJT_11660) sinR 2436322..2436657 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJT_RS11665 (BAJT_11665) tasA 2436705..2437490 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  BAJT_RS11670 (BAJT_11670) sipW 2437555..2438139 (-) 585 WP_032874025.1 signal peptidase I SipW -
  BAJT_RS11675 (BAJT_11675) tapA 2438111..2438782 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BAJT_RS11680 (BAJT_11680) - 2439041..2439370 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BAJT_RS11685 (BAJT_11685) - 2439411..2439590 (-) 180 WP_022552966.1 YqzE family protein -
  BAJT_RS11690 (BAJT_11690) comGG 2439647..2440024 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJT_RS11695 (BAJT_11695) comGF 2440025..2440525 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BAJT_RS11700 (BAJT_11700) comGE 2440434..2440748 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAJT_RS11705 (BAJT_11705) comGD 2440732..2441169 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAJT_RS11710 (BAJT_11710) comGC 2441159..2441425 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BAJT_RS11715 (BAJT_11715) comGB 2441472..2442509 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAJT_RS11720 (BAJT_11720) comGA 2442496..2443566 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BAJT_RS11725 (BAJT_11725) - 2443763..2444713 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  BAJT_RS11730 (BAJT_11730) - 2444859..2446160 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=221912 BAJT_RS11710 WP_042635730.1 2441159..2441425(-) (comGC) [Bacillus velezensis strain JTYP2]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=221912 BAJT_RS11710 WP_042635730.1 2441159..2441425(-) (comGC) [Bacillus velezensis strain JTYP2]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment