Detailed information NTG0198490

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: BJD96_RS06720
• Genome accession: NZ_CP017460
• Coordinates: 1416626..1416943 (+)
• Length: 105 a.a.
• NCBI ID: WP_096809507.1
• Uniprot ID: A0A291JJE4
• Organism: Staphylococcus nepalensis strain JS1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1411626..1421943

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BJD96_RS06690 (BJD96_06605)	-	1412089..1412295 (+)	207	WP_096809496.1	YqgQ family protein	-
BJD96_RS06695 (BJD96_06610)	-	1412595..1413581 (+)	987	WP_096809499.1	glucokinase	-
BJD96_RS06700 (BJD96_06615)	-	1413581..1413907 (+)	327	WP_096809501.1	MTH1187 family thiamine-binding protein	-
BJD96_RS06705 (BJD96_06620)	-	1413907..1414530 (+)	624	WP_096809503.1	MBL fold metallo-hydrolase	-
BJD96_RS06710 (BJD96_06625)	comGA	1414592..1415566 (+)	975	WP_096809505.1	competence type IV pilus ATPase ComGA	Machinery gene
BJD96_RS06715 (BJD96_06630)	comGB	1415538..1416605 (+)	1068	WP_229719007.1	competence type IV pilus assembly protein ComGB	-
BJD96_RS06720 (BJD96_06635)	comGC	1416626..1416943 (+)	318	WP_096809507.1	competence type IV pilus major pilin ComGC	Machinery gene
BJD96_RS06725 (BJD96_06640)	-	1416978..1417373 (+)	396	WP_229719008.1	competence protein	-
BJD96_RS06730 (BJD96_06645)	-	1417354..1417647 (+)	294	WP_096809511.1	hypothetical protein	-
BJD96_RS06735 (BJD96_06650)	-	1417625..1418068 (+)	444	WP_096809514.1	competence type IV pilus minor pilin ComGF	-
BJD96_RS06745 (BJD96_06660)	-	1418246..1418740 (+)	495	WP_174221779.1	shikimate kinase	-
BJD96_RS06750 (BJD96_06665)	gcvT	1418917..1420008 (+)	1092	WP_096809520.1	glycine cleavage system aminomethyltransferase GcvT	-
BJD96_RS06755 (BJD96_06670)	gcvPA	1420026..1421378 (+)	1353	WP_096809522.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11849.03 Da
• Isoelectric Point: 9.4266

>NTDB_id=198490 BJD96_RS06720 WP_096809507.1 1416626..1416943(+) (comGC) [Staphylococcus nepalensis strain JS1]
MHKIKKLYNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQSTGCEAQIKMVESQVEAYTLKHNKKPQSIEELISDG
YIKENQKYCKSGATIHINNGEVVAN

Nucleotide

• Length: 318 bp

>NTDB_id=198490 BJD96_RS06720 WP_096809507.1 1416626..1416943(+) (comGC) [Staphylococcus nepalensis strain JS1]
ATGCATAAAATAAAAAAACTATACAATAAAAAAGCATTCACATTGATTGAAATGCTACTTGTTCTATTAATTATTAGTTT
ATTACTTATCCTTATTATACCTAATATCGCTAAACAATCATCACATATCCAAAGCACTGGTTGTGAAGCACAAATAAAAA
TGGTAGAAAGTCAAGTTGAAGCTTACACATTAAAACATAATAAAAAACCACAATCTATAGAGGAACTTATTTCAGATGGT
TATATCAAAGAAAATCAGAAATATTGTAAATCAGGTGCTACTATCCATATTAATAACGGTGAAGTAGTTGCAAACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

3D structure

• AlphaFold DB: A0A291JJE4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	75.49	97.143	0.733
comGC	Staphylococcus aureus N315	75.49	97.143	0.733
comGC/cglC	Streptococcus mitis SK321	45.833	91.429	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	45.745	89.524	0.41
comGC/cglC	Streptococcus pneumoniae D39	46.667	85.714	0.4
comGC/cglC	Streptococcus pneumoniae R6	46.667	85.714	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	46.667	85.714	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comYC	Streptococcus mutans UA159	46.512	81.905	0.381
comYC	Streptococcus mutans UA140	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371
comGC/cglC	Streptococcus pneumoniae TIGR4	50	72.381	0.362
comYC	Streptococcus suis isolate S10	50	72.381	0.362