Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   FORC48_RS19825 Genome accession   NZ_CP017234
Coordinates   3798136..3798915 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain FORC_048     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3772840..3834602 3798136..3798915 within 0


Gene organization within MGE regions


Location: 3772840..3834602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC48_RS19715 (FORC48_3817) - 3773411..3774310 (-) 900 WP_000868224.1 polysaccharide deacetylase family protein -
  FORC48_RS19720 (FORC48_3818) pnp 3774464..3776602 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  FORC48_RS19725 (FORC48_3819) rpsO 3776763..3777032 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FORC48_RS19730 (FORC48_3820) ribF 3777133..3778104 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  FORC48_RS19735 (FORC48_3821) truB 3778148..3779071 (-) 924 WP_000399350.1 tRNA pseudouridine(55) synthase TruB -
  FORC48_RS19740 (FORC48_3822) rbfA 3779158..3779514 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  FORC48_RS19745 (FORC48_3823) - 3779530..3779811 (-) 282 WP_000582363.1 DUF503 family protein -
  FORC48_RS19750 (FORC48_3824) infB 3779808..3781868 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  FORC48_RS19755 (FORC48_3825) - 3781873..3782184 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FORC48_RS19760 (FORC48_3826) - 3782185..3782457 (-) 273 WP_000071127.1 YlxR family protein -
  FORC48_RS19765 (FORC48_3827) nusA 3782469..3783575 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  FORC48_RS19770 (FORC48_3828) rimP 3783593..3784063 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  FORC48_RS19775 (FORC48_3829) - 3784400..3788701 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  FORC48_RS19780 (FORC48_3830) - 3788826..3790526 (-) 1701 WP_000814300.1 proline--tRNA ligase -
  FORC48_RS19785 (FORC48_3831) rseP 3790636..3791892 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  FORC48_RS19790 (FORC48_3832) dxr 3791910..3793052 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FORC48_RS19795 (FORC48_3833) cdsA 3793076..3793867 (-) 792 WP_000813594.1 phosphatidate cytidylyltransferase -
  FORC48_RS19800 (FORC48_3835) uppS 3793885..3794661 (-) 777 WP_000971296.1 isoprenyl transferase -
  FORC48_RS19805 (FORC48_3836) frr 3794747..3795304 (-) 558 WP_000531501.1 ribosome recycling factor -
  FORC48_RS19810 (FORC48_3837) pyrH 3795307..3796029 (-) 723 WP_000042668.1 UMP kinase -
  FORC48_RS19815 (FORC48_3838) tsf 3796096..3796983 (-) 888 WP_001018578.1 translation elongation factor Ts -
  FORC48_RS19820 (FORC48_3839) rpsB 3797087..3797788 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  FORC48_RS19825 (FORC48_3840) codY 3798136..3798915 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FORC48_RS19830 (FORC48_3841) hslU 3798993..3800384 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  FORC48_RS19835 (FORC48_3842) hslV 3800407..3800949 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FORC48_RS19840 (FORC48_3843) xerC 3800992..3801891 (-) 900 WP_025709042.1 tyrosine recombinase XerC -
  FORC48_RS19845 (FORC48_3844) trmFO 3801957..3803261 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FORC48_RS19850 (FORC48_3845) topA 3803310..3805388 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  FORC48_RS19855 (FORC48_3846) dprA 3805533..3806402 (-) 870 WP_000818043.1 DNA-processing protein DprA -
  FORC48_RS19860 (FORC48_3847) sucD 3806491..3807393 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FORC48_RS19865 (FORC48_3848) sucC 3807413..3808573 (-) 1161 WP_088867893.1 ADP-forming succinate--CoA ligase subunit beta -
  FORC48_RS19870 (FORC48_3849) - 3808768..3809541 (-) 774 WP_001194265.1 ribonuclease HII -
  FORC48_RS19875 (FORC48_3850) ylqF 3809598..3810488 (-) 891 WP_088867894.1 ribosome biogenesis GTPase YlqF -
  FORC48_RS19880 (FORC48_3851) lepB 3810509..3811060 (-) 552 WP_000711853.1 signal peptidase I -
  FORC48_RS19885 (FORC48_3852) rplS 3811162..3811506 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FORC48_RS19890 (FORC48_3853) trmD 3811653..3812387 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FORC48_RS19895 (FORC48_3854) rimM 3812387..3812902 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  FORC48_RS19900 (FORC48_3855) - 3813024..3813251 (-) 228 WP_000737401.1 KH domain-containing protein -
  FORC48_RS19905 (FORC48_3856) rpsP 3813266..3813538 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FORC48_RS19910 (FORC48_3857) ffh 3813640..3814989 (-) 1350 WP_000863460.1 signal recognition particle protein -
  FORC48_RS19915 (FORC48_3858) - 3815002..3815334 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FORC48_RS19920 (FORC48_3859) ftsY 3815468..3816457 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  FORC48_RS19925 (FORC48_3860) smc 3816473..3820042 (-) 3570 WP_088867895.1 chromosome segregation protein SMC -
  FORC48_RS19930 (FORC48_3861) rncS 3820189..3820926 (-) 738 WP_001146875.1 ribonuclease III -
  FORC48_RS19935 (FORC48_3862) acpP 3820985..3821218 (-) 234 WP_000786062.1 acyl carrier protein -
  FORC48_RS19940 (FORC48_3863) fabG 3821288..3822028 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FORC48_RS19945 (FORC48_3864) fabD 3822028..3822972 (-) 945 WP_000515900.1 ACP S-malonyltransferase -
  FORC48_RS19950 (FORC48_3865) plsX 3822987..3823979 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  FORC48_RS19955 (FORC48_3866) fapR 3823976..3824569 (-) 594 WP_000747348.1 transcription factor FapR -
  FORC48_RS19960 (FORC48_3867) recG 3824658..3826706 (-) 2049 WP_001000813.1 ATP-dependent DNA helicase RecG -
  FORC48_RS19965 (FORC48_3868) - 3826997..3828673 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  FORC48_RS19970 (FORC48_3869) - 3828696..3829058 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FORC48_RS19975 (FORC48_3870) rpmB 3829435..3829623 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FORC48_RS19980 (FORC48_3871) spoVM 3829697..3829777 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FORC48_RS19985 (FORC48_3872) - 3829844..3830524 (-) 681 WP_000752663.1 thiamine diphosphokinase -
  FORC48_RS19990 (FORC48_3873) rpe 3830594..3831238 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  FORC48_RS19995 (FORC48_3874) rsgA 3831241..3832122 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  FORC48_RS20000 (FORC48_3875) pknB 3832369..3834342 (-) 1974 WP_000904748.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=196736 FORC48_RS19825 WP_000421290.1 3798136..3798915(-) (codY) [Bacillus cereus strain FORC_048]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=196736 FORC48_RS19825 WP_000421290.1 3798136..3798915(-) (codY) [Bacillus cereus strain FORC_048]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment