Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FORC47_RS19735 Genome accession   NZ_CP017060
Coordinates   3782717..3783496 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain FORC_047     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3757418..3819181 3782717..3783496 within 0


Gene organization within MGE regions


Location: 3757418..3819181
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC47_RS19625 (FORC47_3732) - 3757989..3758888 (-) 900 WP_089171666.1 polysaccharide deacetylase family protein -
  FORC47_RS19630 (FORC47_3733) pnp 3759041..3761179 (-) 2139 WP_000076745.1 polyribonucleotide nucleotidyltransferase -
  FORC47_RS19635 (FORC47_3734) rpsO 3761340..3761609 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FORC47_RS19640 (FORC47_3735) ribF 3761710..3762681 (-) 972 WP_000766703.1 bifunctional riboflavin kinase/FAD synthetase -
  FORC47_RS19645 (FORC47_3736) truB 3762725..3763648 (-) 924 WP_000399362.1 tRNA pseudouridine(55) synthase TruB -
  FORC47_RS19650 (FORC47_3737) rbfA 3763735..3764091 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  FORC47_RS19655 (FORC47_3738) - 3764107..3764388 (-) 282 WP_000634349.1 DUF503 domain-containing protein -
  FORC47_RS19660 (FORC47_3739) infB 3764385..3766451 (-) 2067 WP_000036347.1 translation initiation factor IF-2 -
  FORC47_RS19665 (FORC47_3740) - 3766456..3766767 (-) 312 WP_001286522.1 YlxQ family RNA-binding protein -
  FORC47_RS19670 (FORC47_3741) rnpM 3766768..3767040 (-) 273 WP_000071125.1 RNase P modulator RnpM -
  FORC47_RS19675 (FORC47_3742) nusA 3767052..3768158 (-) 1107 WP_000102598.1 transcription termination factor NusA -
  FORC47_RS19680 (FORC47_3743) rimP 3768176..3768646 (-) 471 WP_000359095.1 ribosome maturation factor RimP -
  FORC47_RS19685 (FORC47_3744) - 3768980..3773281 (-) 4302 WP_089171667.1 PolC-type DNA polymerase III -
  FORC47_RS19690 (FORC47_3745) - 3773406..3775106 (-) 1701 WP_016080534.1 proline--tRNA ligase -
  FORC47_RS19695 (FORC47_3746) rseP 3775216..3776472 (-) 1257 WP_001090233.1 RIP metalloprotease RseP -
  FORC47_RS19700 (FORC47_3747) dxr 3776490..3777632 (-) 1143 WP_000790379.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FORC47_RS19705 (FORC47_3748) cdsA 3777656..3778447 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  FORC47_RS19710 (FORC47_3749) uppS 3778465..3779241 (-) 777 WP_089171668.1 isoprenyl transferase -
  FORC47_RS19715 (FORC47_3750) frr 3779327..3779884 (-) 558 WP_000531505.1 ribosome recycling factor -
  FORC47_RS19720 (FORC47_3751) pyrH 3779887..3780609 (-) 723 WP_000042669.1 UMP kinase -
  FORC47_RS19725 (FORC47_3752) tsf 3780676..3781563 (-) 888 WP_016080531.1 translation elongation factor Ts -
  FORC47_RS19730 (FORC47_3753) rpsB 3781667..3782368 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  FORC47_RS19735 (FORC47_3754) codY 3782717..3783496 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FORC47_RS19740 (FORC47_3755) hslU 3783574..3784965 (-) 1392 WP_089171669.1 ATP-dependent protease ATPase subunit HslU -
  FORC47_RS19745 (FORC47_3756) hslV 3784988..3785530 (-) 543 WP_000526274.1 ATP-dependent protease proteolytic subunit HslV -
  FORC47_RS19750 (FORC47_3757) xerC 3785573..3786472 (-) 900 WP_001101245.1 tyrosine recombinase XerC -
  FORC47_RS19755 (FORC47_3758) trmFO 3786538..3787842 (-) 1305 WP_000213006.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FORC47_RS19760 (FORC47_3759) topA 3787891..3789969 (-) 2079 WP_001286955.1 type I DNA topoisomerase -
  FORC47_RS19765 (FORC47_3760) dprA 3790114..3790983 (-) 870 WP_000818046.1 DNA-processing protein DprA -
  FORC47_RS19770 (FORC47_3761) sucD 3791071..3791973 (-) 903 WP_089171670.1 succinate--CoA ligase subunit alpha -
  FORC47_RS19775 (FORC47_3762) sucC 3791993..3793153 (-) 1161 WP_089171671.1 ADP-forming succinate--CoA ligase subunit beta -
  FORC47_RS19780 (FORC47_3763) - 3793347..3794120 (-) 774 WP_089171672.1 ribonuclease HII -
  FORC47_RS19785 (FORC47_3764) ylqF 3794177..3795067 (-) 891 WP_089171673.1 ribosome biogenesis GTPase YlqF -
  FORC47_RS19790 (FORC47_3765) lepB 3795088..3795639 (-) 552 WP_000711852.1 signal peptidase I -
  FORC47_RS19795 (FORC47_3766) rplS 3795741..3796085 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FORC47_RS19800 (FORC47_3767) trmD 3796232..3796966 (-) 735 WP_000686899.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FORC47_RS19805 (FORC47_3768) rimM 3796966..3797481 (-) 516 WP_000170272.1 ribosome maturation factor RimM -
  FORC47_RS19810 (FORC47_3769) - 3797602..3797829 (-) 228 WP_000737399.1 KH domain-containing protein -
  FORC47_RS19815 (FORC47_3770) rpsP 3797844..3798116 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FORC47_RS19820 (FORC47_3771) ffh 3798218..3799567 (-) 1350 WP_000863460.1 signal recognition particle protein -
  FORC47_RS19825 (FORC47_3772) - 3799580..3799912 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FORC47_RS19830 (FORC47_3773) ftsY 3800045..3801034 (-) 990 WP_000007642.1 signal recognition particle-docking protein FtsY -
  FORC47_RS19835 (FORC47_3774) smc 3801050..3804619 (-) 3570 WP_089171674.1 chromosome segregation protein SMC -
  FORC47_RS19840 (FORC47_3775) rncS 3804767..3805504 (-) 738 WP_001146875.1 ribonuclease III -
  FORC47_RS19845 (FORC47_3776) acpP 3805563..3805796 (-) 234 WP_000786062.1 acyl carrier protein -
  FORC47_RS19850 (FORC47_3777) fabG 3805866..3806606 (-) 741 WP_000911769.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FORC47_RS19855 (FORC47_3778) fabD 3806606..3807550 (-) 945 WP_089171675.1 ACP S-malonyltransferase -
  FORC47_RS19860 (FORC47_3779) plsX 3807565..3808557 (-) 993 WP_089171676.1 phosphate acyltransferase PlsX -
  FORC47_RS19865 (FORC47_3780) fapR 3808554..3809147 (-) 594 WP_000747349.1 transcription factor FapR -
  FORC47_RS19870 (FORC47_3781) recG 3809236..3811284 (-) 2049 WP_001000823.1 ATP-dependent DNA helicase RecG -
  FORC47_RS19875 (FORC47_3782) - 3811575..3813251 (-) 1677 WP_000027131.1 DAK2 domain-containing protein -
  FORC47_RS19880 (FORC47_3783) - 3813274..3813636 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FORC47_RS19885 (FORC47_3784) rpmB 3814013..3814201 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FORC47_RS19890 spoVM 3814275..3814355 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FORC47_RS19895 (FORC47_3785) - 3814422..3815102 (-) 681 WP_000752665.1 thiamine diphosphokinase -
  FORC47_RS19900 (FORC47_3786) rpe 3815172..3815816 (-) 645 WP_089171677.1 ribulose-phosphate 3-epimerase -
  FORC47_RS19905 (FORC47_3787) rsgA 3815819..3816700 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  FORC47_RS19910 (FORC47_3788) pknB 3816948..3818921 (-) 1974 WP_089171678.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=194875 FORC47_RS19735 WP_000421290.1 3782717..3783496(-) (codY) [Bacillus cereus strain FORC_047]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=194875 FORC47_RS19735 WP_000421290.1 3782717..3783496(-) (codY) [Bacillus cereus strain FORC_047]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCGGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGTGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGACGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGCATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGTGTAGGGATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTAATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment