Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   CCX85_RS00675 Genome accession   NZ_CP021640
Coordinates   104723..105007 (+) Length   94 a.a.
NCBI ID   WP_265415267.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain JS12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99723..110007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CCX85_RS00650 (CCX85_00650) - 101669..102034 (+) 366 WP_002986560.1 DUF1033 family protein -
  CCX85_RS00655 (CCX85_00655) comGA 102127..103065 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  CCX85_RS00660 (CCX85_00660) comGB 103001..104035 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  CCX85_RS00665 (CCX85_00665) comGC 104037..104363 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  CCX85_RS00670 (CCX85_00670) comGD 104338..104766 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  CCX85_RS00675 (CCX85_00675) comGE 104723..105007 (+) 285 WP_265415267.1 competence type IV pilus minor pilin ComGE Machinery gene
  CCX85_RS00680 (CCX85_00680) comGF 105000..105434 (+) 435 WP_020833199.1 competence type IV pilus minor pilin ComGF Machinery gene
  CCX85_RS00685 (CCX85_00685) comGG 105418..105744 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  CCX85_RS00690 (CCX85_00690) comGH 105842..106795 (+) 954 WP_101248261.1 class I SAM-dependent methyltransferase Machinery gene
  CCX85_RS00695 (CCX85_00695) - 106854..108050 (+) 1197 WP_002987791.1 acetate kinase -
  CCX85_RS00700 (CCX85_00700) - 108237..108545 (+) 309 WP_010921804.1 hypothetical protein -
  CCX85_RS00705 (CCX85_00705) proC 108628..109398 (-) 771 WP_101248262.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10644.61 Da        Isoelectric Point: 8.8950

>NTDB_id=194407 CCX85_RS00675 WP_265415267.1 104723..105007(+) (comGE) [Streptococcus pyogenes strain JS12]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTKTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=194407 CCX85_RS00675 WP_265415267.1 104723..105007(+) (comGE) [Streptococcus pyogenes strain JS12]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACATACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAAAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment