Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   FORC39_RS04505 Genome accession   NZ_CP015817
Coordinates   890121..890564 (+) Length   147 a.a.
NCBI ID   WP_086353408.1    Uniprot ID   -
Organism   Staphylococcus aureus strain FORC_039     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 880411..921763 890121..890564 within 0


Gene organization within MGE regions


Location: 880411..921763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC39_RS04420 (FORC39_0782) sufB 880411..881808 (+) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
  FORC39_RS04425 (FORC39_0783) - 881876..882925 (-) 1050 WP_086353406.1 tyrosine-type recombinase/integrase -
  FORC39_RS04430 (FORC39_0784) - 883038..883217 (+) 180 WP_000337826.1 hypothetical protein -
  FORC39_RS04435 (FORC39_0785) - 883197..884129 (-) 933 WP_000392186.1 hypothetical protein -
  FORC39_RS04440 (FORC39_0786) - 884161..884886 (-) 726 WP_000661437.1 PH domain-containing protein -
  FORC39_RS04445 (FORC39_0787) - 884914..885588 (-) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  FORC39_RS04450 (FORC39_0788) - 885605..885937 (-) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  FORC39_RS04455 (FORC39_0789) - 886200..886394 (+) 195 WP_086353407.1 helix-turn-helix transcriptional regulator -
  FORC39_RS04460 (FORC39_0790) - 886394..887161 (+) 768 WP_001002757.1 phage antirepressor Ant -
  FORC39_RS04465 (FORC39_0791) - 887162..887386 (+) 225 WP_000187184.1 hypothetical protein -
  FORC39_RS04470 (FORC39_0792) - 887426..887875 (+) 450 WP_001094943.1 hypothetical protein -
  FORC39_RS04475 (FORC39_0793) - 887889..888110 (+) 222 WP_000977381.1 hypothetical protein -
  FORC39_RS04480 - 888103..888264 (+) 162 WP_000066011.1 DUF1270 domain-containing protein -
  FORC39_RS04485 (FORC39_0794) - 888357..888659 (+) 303 WP_000165363.1 DUF2482 family protein -
  FORC39_RS04490 (FORC39_0795) - 888664..888924 (+) 261 WP_000291067.1 DUF1108 family protein -
  FORC39_RS04495 (FORC39_0796) - 888937..889473 (+) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  FORC39_RS04500 (FORC39_0797) - 889474..890124 (+) 651 WP_000840496.1 ERF family protein -
  FORC39_RS04505 (FORC39_0798) ssbA 890121..890564 (+) 444 WP_086353408.1 single-stranded DNA-binding protein Machinery gene
  FORC39_RS04510 (FORC39_0799) - 890576..891250 (+) 675 WP_086353409.1 putative HNHc nuclease -
  FORC39_RS04515 (FORC39_0800) - 891243..891986 (+) 744 WP_039702431.1 hypothetical protein -
  FORC39_RS04520 (FORC39_0801) - 891996..892775 (+) 780 WP_031880733.1 ATP-binding protein -
  FORC39_RS14805 (FORC39_0802) - 892769..892930 (+) 162 WP_000237153.1 hypothetical protein -
  FORC39_RS04530 (FORC39_0803) - 892943..893164 (+) 222 WP_001123673.1 DUF3269 family protein -
  FORC39_RS04535 (FORC39_0804) - 893175..893579 (+) 405 WP_000049784.1 DUF1064 domain-containing protein -
  FORC39_RS04540 (FORC39_0805) - 893584..893769 (+) 186 WP_001187240.1 DUF3113 family protein -
  FORC39_RS04545 (FORC39_0806) - 893770..894390 (+) 621 WP_000907416.1 SA1788 family PVL leukocidin-associated protein -
  FORC39_RS04550 (FORC39_0807) - 894387..894644 (+) 258 WP_000111490.1 DUF3310 domain-containing protein -
  FORC39_RS04555 (FORC39_0808) - 894647..894847 (+) 201 WP_000235327.1 hypothetical protein -
  FORC39_RS04560 (FORC39_0809) - 894856..895104 (+) 249 WP_072497105.1 SAV1978 family virulence-associated passenger protein -
  FORC39_RS04565 (FORC39_0810) - 895118..895522 (+) 405 WP_000694059.1 hypothetical protein -
  FORC39_RS04570 (FORC39_0811) - 895522..895797 (+) 276 WP_015978314.1 hypothetical protein -
  FORC39_RS04575 (FORC39_0812) - 895790..896038 (+) 249 WP_064266706.1 DUF1024 family protein -
  FORC39_RS04580 (FORC39_0813) - 896031..896540 (+) 510 WP_031911468.1 dUTP diphosphatase -
  FORC39_RS04585 (FORC39_0814) - 896577..896822 (+) 246 WP_001282070.1 hypothetical protein -
  FORC39_RS04590 (FORC39_0815) - 896819..897007 (+) 189 WP_000195795.1 DUF1381 domain-containing protein -
  FORC39_RS04595 (FORC39_0816) - 896982..897182 (+) 201 WP_000039541.1 hypothetical protein -
  FORC39_RS04600 (FORC39_0817) - 897185..897334 (+) 150 WP_000237868.1 transcriptional activator RinB -
  FORC39_RS04605 (FORC39_0818) - 897334..897534 (+) 201 WP_000265043.1 DUF1514 family protein -
  FORC39_RS04610 (FORC39_0819) - 897562..897978 (+) 417 WP_000590122.1 hypothetical protein -
  FORC39_RS04615 (FORC39_0820) - 898210..898509 (+) 300 WP_000988330.1 HNH endonuclease -
  FORC39_RS04620 (FORC39_0821) - 898639..898983 (+) 345 WP_000402904.1 hypothetical protein -
  FORC39_RS04625 (FORC39_0822) - 898980..900641 (+) 1662 WP_000625088.1 terminase large subunit -
  FORC39_RS04630 (FORC39_0823) - 900657..901844 (+) 1188 WP_000025274.1 phage portal protein -
  FORC39_RS04635 (FORC39_0824) - 901828..902565 (+) 738 WP_000642728.1 head maturation protease, ClpP-related -
  FORC39_RS04640 (FORC39_0825) - 902589..903734 (+) 1146 WP_000154559.1 phage major capsid protein -
  FORC39_RS04645 (FORC39_0826) - 903754..904038 (+) 285 WP_031807821.1 hypothetical protein -
  FORC39_RS04650 (FORC39_0827) - 904028..904312 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  FORC39_RS04655 (FORC39_0828) - 904296..904658 (+) 363 WP_000755150.1 head-tail adaptor protein -
  FORC39_RS04660 (FORC39_0829) - 904655..905059 (+) 405 WP_000114225.1 HK97 gp10 family phage protein -
  FORC39_RS04665 (FORC39_0830) - 905056..905463 (+) 408 WP_000565498.1 hypothetical protein -
  FORC39_RS04670 (FORC39_0831) - 905464..906108 (+) 645 WP_000268740.1 major tail protein -
  FORC39_RS04675 - 906144..906374 (+) 231 Protein_875 Ig-like domain-containing protein -
  FORC39_RS04680 (FORC39_0832) - 906424..906774 (+) 351 WP_001096355.1 hypothetical protein -
  FORC39_RS14810 - 906825..906962 (+) 138 WP_001549167.1 hypothetical protein -
  FORC39_RS04685 (FORC39_0833) - 907019..911563 (+) 4545 WP_086353410.1 phage tail tape measure protein -
  FORC39_RS04690 (FORC39_0834) - 911560..913044 (+) 1485 WP_000567390.1 phage tail domain-containing protein -
  FORC39_RS04695 (FORC39_0835) - 913060..916845 (+) 3786 WP_000582178.1 phage tail spike protein -
  FORC39_RS04700 (FORC39_0836) - 916835..916987 (+) 153 WP_001153681.1 hypothetical protein -
  FORC39_RS04705 (FORC39_0837) - 917034..917321 (+) 288 WP_001040261.1 hypothetical protein -
  FORC39_RS04710 (FORC39_0838) - 917379..917675 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  FORC39_RS04715 (FORC39_0839) pepG1 917867..918001 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  FORC39_RS04720 - 918054..918161 (-) 108 WP_031866188.1 hypothetical protein -
  FORC39_RS04725 (FORC39_0840) - 918213..918467 (+) 255 WP_000611512.1 phage holin -
  FORC39_RS04730 - 918479..919234 (+) 756 Protein_887 CHAP domain-containing protein -
  FORC39_RS04735 (FORC39_0843) sak 919425..919916 (+) 492 WP_000920038.1 staphylokinase -
  FORC39_RS04755 (FORC39_0844) - 920567..920902 (+) 336 Protein_889 SH3 domain-containing protein -
  FORC39_RS04760 (FORC39_0845) scn 921413..921763 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence

Protein


Download         Length: 147 a.a.        Molecular weight: 16351.91 Da        Isoelectric Point: 5.8347

>NTDB_id=182242 FORC39_RS04505 WP_086353408.1 890121..890564(+) (ssbA) [Staphylococcus aureus strain FORC_039]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNTPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=182242 FORC39_RS04505 WP_086353408.1 890121..890564(+) (ssbA) [Staphylococcus aureus strain FORC_039]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGATTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACACACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-100)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

39.444

100

0.483
  ssb Latilactobacillus sakei subsp. sakei 23K

38.824

100

0.449

Multiple sequence alignment