Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   BTI679_RS19785 Genome accession   NZ_CP015257
Coordinates   3840870..3841649 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus wiedmannii strain Bt18679     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3804585..3875743 3840870..3841649 within 0


Gene organization within MGE regions


Location: 3804585..3875743
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTI679_RS19625 (BTI679_39850) - 3805818..3806021 (-) 204 WP_000605035.1 YlzJ-like family protein -
  BTI679_RS19630 (BTI679_39860) tepA 3806018..3806767 (-) 750 WP_000139828.1 translocation-enhancing protein TepA -
  BTI679_RS19635 (BTI679_39870) - 3806872..3808542 (-) 1671 WP_000823080.1 ribonuclease J -
  BTI679_RS19640 (BTI679_39880) dapA 3809320..3810198 (-) 879 WP_000564777.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BTI679_RS19645 (BTI679_39890) dapG 3810210..3811442 (-) 1233 WP_064475022.1 aspartate kinase -
  BTI679_RS19650 (BTI679_39900) asd 3811466..3812512 (-) 1047 WP_000414854.1 aspartate-semialdehyde dehydrogenase -
  BTI679_RS19655 (BTI679_39910) dpaB 3812663..3813262 (-) 600 WP_001049480.1 dipicolinate synthase subunit B -
  BTI679_RS19660 (BTI679_39920) dpaA 3813259..3814161 (-) 903 WP_000954740.1 dipicolinic acid synthetase subunit A -
  BTI679_RS19665 (BTI679_39930) - 3814436..3814687 (-) 252 WP_064475021.1 YlmC/YmxH family sporulation protein -
  BTI679_RS19670 (BTI679_39940) - 3814818..3816059 (-) 1242 WP_000593005.1 pitrilysin family protein -
  BTI679_RS19675 (BTI679_39950) - 3816146..3817045 (-) 900 WP_064475020.1 polysaccharide deacetylase family protein -
  BTI679_RS19680 (BTI679_39960) pnp 3817198..3819336 (-) 2139 WP_046957398.1 polyribonucleotide nucleotidyltransferase -
  BTI679_RS19685 (BTI679_39970) rpsO 3819497..3819766 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BTI679_RS19690 (BTI679_39980) ribF 3819867..3820838 (-) 972 WP_064475019.1 bifunctional riboflavin kinase/FAD synthetase -
  BTI679_RS19695 (BTI679_39990) truB 3820882..3821805 (-) 924 WP_076539679.1 tRNA pseudouridine(55) synthase TruB -
  BTI679_RS19700 (BTI679_40000) rbfA 3821892..3822248 (-) 357 WP_000776445.1 30S ribosome-binding factor RbfA -
  BTI679_RS19705 (BTI679_40010) - 3822264..3822545 (-) 282 WP_000582364.1 DUF503 family protein -
  BTI679_RS19710 (BTI679_40020) infB 3822542..3824602 (-) 2061 WP_064475018.1 translation initiation factor IF-2 -
  BTI679_RS19715 (BTI679_40030) - 3824607..3824918 (-) 312 WP_001286521.1 YlxQ family RNA-binding protein -
  BTI679_RS19720 (BTI679_40040) - 3824919..3825191 (-) 273 WP_000071127.1 YlxR family protein -
  BTI679_RS19725 (BTI679_40050) nusA 3825203..3826309 (-) 1107 WP_000102596.1 transcription termination factor NusA -
  BTI679_RS19730 (BTI679_40060) rimP 3826327..3826797 (-) 471 WP_000359098.1 ribosome maturation factor RimP -
  BTI679_RS19735 (BTI679_40070) - 3827131..3831432 (-) 4302 WP_064475017.1 PolC-type DNA polymerase III -
  BTI679_RS19740 (BTI679_40080) - 3831557..3833257 (-) 1701 WP_064475016.1 proline--tRNA ligase -
  BTI679_RS19745 (BTI679_40090) rseP 3833367..3834623 (-) 1257 WP_142315321.1 RIP metalloprotease RseP -
  BTI679_RS19750 (BTI679_40100) dxr 3834641..3835783 (-) 1143 WP_098110640.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BTI679_RS19755 (BTI679_40110) cdsA 3835807..3836598 (-) 792 WP_064475013.1 phosphatidate cytidylyltransferase -
  BTI679_RS19760 (BTI679_40120) uppS 3836616..3837392 (-) 777 WP_064475012.1 isoprenyl transferase -
  BTI679_RS19765 (BTI679_40130) frr 3837478..3838035 (-) 558 WP_000531506.1 ribosome recycling factor -
  BTI679_RS19770 (BTI679_40140) pyrH 3838038..3838760 (-) 723 WP_000042666.1 UMP kinase -
  BTI679_RS19775 (BTI679_40150) tsf 3838827..3839714 (-) 888 WP_098110641.1 translation elongation factor Ts -
  BTI679_RS19780 (BTI679_40160) rpsB 3839818..3840519 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  BTI679_RS19785 (BTI679_40170) codY 3840870..3841649 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BTI679_RS19790 (BTI679_40180) hslU 3841727..3843118 (-) 1392 WP_000550070.1 ATP-dependent protease ATPase subunit HslU -
  BTI679_RS19795 (BTI679_40190) hslV 3843141..3843683 (-) 543 WP_103654910.1 ATP-dependent protease proteolytic subunit HslV -
  BTI679_RS19800 (BTI679_40200) xerC 3843726..3844625 (-) 900 WP_001101235.1 tyrosine recombinase XerC -
  BTI679_RS19805 (BTI679_40210) trmFO 3844691..3845995 (-) 1305 WP_064475009.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BTI679_RS19810 (BTI679_40220) topA 3846044..3848122 (-) 2079 WP_001286953.1 type I DNA topoisomerase -
  BTI679_RS19815 (BTI679_40230) dprA 3848267..3849136 (-) 870 WP_088047267.1 DNA-processing protein DprA -
  BTI679_RS19820 (BTI679_40240) sucD 3849224..3850126 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BTI679_RS19825 (BTI679_40250) sucC 3850146..3851306 (-) 1161 WP_001020778.1 ADP-forming succinate--CoA ligase subunit beta -
  BTI679_RS19830 (BTI679_40260) - 3851501..3852274 (-) 774 WP_064475007.1 ribonuclease HII -
  BTI679_RS19835 (BTI679_40270) ylqF 3852327..3853217 (-) 891 WP_048546006.1 ribosome biogenesis GTPase YlqF -
  BTI679_RS19840 (BTI679_40280) lepB 3853238..3853789 (-) 552 WP_000711857.1 signal peptidase I -
  BTI679_RS19845 (BTI679_40290) rplS 3853891..3854235 (-) 345 WP_001186518.1 50S ribosomal protein L19 -
  BTI679_RS19850 (BTI679_40300) trmD 3854382..3855116 (-) 735 WP_064475006.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BTI679_RS19855 (BTI679_40310) rimM 3855116..3855631 (-) 516 WP_000170282.1 ribosome maturation factor RimM -
  BTI679_RS19860 (BTI679_40320) - 3855753..3855980 (-) 228 WP_000737397.1 KH domain-containing protein -
  BTI679_RS19865 (BTI679_40330) rpsP 3855995..3856267 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BTI679_RS19870 (BTI679_40340) ffh 3856368..3857717 (-) 1350 WP_048546014.1 signal recognition particle protein -
  BTI679_RS19875 (BTI679_40350) - 3857730..3858062 (-) 333 WP_000891061.1 putative DNA-binding protein -
  BTI679_RS19880 (BTI679_40360) ftsY 3858196..3859185 (-) 990 WP_000007644.1 signal recognition particle-docking protein FtsY -
  BTI679_RS19885 (BTI679_40370) smc 3859201..3862770 (-) 3570 WP_064475004.1 chromosome segregation protein SMC -
  BTI679_RS19890 (BTI679_40380) rncS 3862918..3863655 (-) 738 WP_001146867.1 ribonuclease III -
  BTI679_RS19895 (BTI679_40390) acpP 3863714..3863947 (-) 234 WP_000786062.1 acyl carrier protein -
  BTI679_RS19900 (BTI679_40400) fabG 3864017..3864757 (-) 741 WP_064475003.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BTI679_RS19905 (BTI679_40410) fabD 3864757..3865701 (-) 945 WP_064475002.1 ACP S-malonyltransferase -
  BTI679_RS19910 (BTI679_40420) plsX 3865716..3866708 (-) 993 WP_046956482.1 phosphate acyltransferase PlsX -
  BTI679_RS19915 (BTI679_40430) fapR 3866705..3867298 (-) 594 WP_000747354.1 transcription factor FapR -
  BTI679_RS19920 (BTI679_40440) recG 3867387..3869435 (-) 2049 WP_064475000.1 ATP-dependent DNA helicase RecG -
  BTI679_RS19925 (BTI679_40450) - 3869719..3871395 (-) 1677 WP_088047265.1 DAK2 domain-containing protein -
  BTI679_RS19930 (BTI679_40460) - 3871418..3871780 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BTI679_RS19935 (BTI679_40470) rpmB 3872156..3872344 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  BTI679_RS19940 spoVM 3872418..3872498 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BTI679_RS19945 (BTI679_40480) - 3872565..3873245 (-) 681 WP_064474998.1 thiamine diphosphokinase -
  BTI679_RS19950 (BTI679_40490) rpe 3873345..3873989 (-) 645 WP_061678216.1 ribulose-phosphate 3-epimerase -
  BTI679_RS19955 (BTI679_40500) rsgA 3873992..3874873 (-) 882 WP_064474997.1 ribosome small subunit-dependent GTPase A -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=178126 BTI679_RS19785 WP_000421290.1 3840870..3841649(-) (codY) [Bacillus wiedmannii strain Bt18679]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=178126 BTI679_RS19785 WP_000421290.1 3840870..3841649(-) (codY) [Bacillus wiedmannii strain Bt18679]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATTGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCGGAAGAATACACGCAAAGCTTATTC
AACATTACAGAAACATCTTCGAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTTTAGGCACATTAGTGTTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATCCTTGCTGAATACAGTTCAACTGTAGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCAATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAATTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment