Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   Bt4C1_RS18725 Genome accession   NZ_CP015176
Coordinates   3721187..3721966 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus thuringiensis serovar alesti strain BGSC 4C1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3695888..3757649 3721187..3721966 within 0


Gene organization within MGE regions


Location: 3695888..3757649
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Bt4C1_RS18615 (Bt4C1_18620) - 3696459..3697358 (-) 900 WP_000868231.1 polysaccharide deacetylase family protein -
  Bt4C1_RS18620 (Bt4C1_18625) pnp 3697511..3699649 (-) 2139 WP_000076744.1 polyribonucleotide nucleotidyltransferase -
  Bt4C1_RS18625 (Bt4C1_18630) rpsO 3699810..3700079 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  Bt4C1_RS18630 (Bt4C1_18635) ribF 3700180..3701151 (-) 972 WP_063675623.1 bifunctional riboflavin kinase/FAD synthetase -
  Bt4C1_RS18635 (Bt4C1_18640) truB 3701195..3702118 (-) 924 WP_000399365.1 tRNA pseudouridine(55) synthase TruB -
  Bt4C1_RS18640 (Bt4C1_18645) rbfA 3702206..3702562 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  Bt4C1_RS18645 (Bt4C1_18650) - 3702578..3702859 (-) 282 WP_000634349.1 DUF503 family protein -
  Bt4C1_RS18650 (Bt4C1_18655) infB 3702856..3704922 (-) 2067 WP_000036346.1 translation initiation factor IF-2 -
  Bt4C1_RS18655 (Bt4C1_18660) - 3704927..3705238 (-) 312 WP_001286522.1 YlxQ family RNA-binding protein -
  Bt4C1_RS18660 (Bt4C1_18665) - 3705239..3705511 (-) 273 WP_000071123.1 YlxR family protein -
  Bt4C1_RS18665 (Bt4C1_18670) nusA 3705523..3706629 (-) 1107 WP_000102598.1 transcription termination factor NusA -
  Bt4C1_RS18670 (Bt4C1_18675) rimP 3706647..3707117 (-) 471 WP_000359095.1 ribosome maturation factor RimP -
  Bt4C1_RS18675 (Bt4C1_18680) - 3707451..3711752 (-) 4302 WP_000059996.1 PolC-type DNA polymerase III -
  Bt4C1_RS18680 (Bt4C1_18685) - 3711877..3713577 (-) 1701 WP_000814295.1 proline--tRNA ligase -
  Bt4C1_RS18685 (Bt4C1_18690) rseP 3713687..3714943 (-) 1257 WP_001090241.1 RIP metalloprotease RseP -
  Bt4C1_RS18690 (Bt4C1_18695) dxr 3714961..3716103 (-) 1143 WP_000790358.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  Bt4C1_RS18695 (Bt4C1_18700) cdsA 3716127..3716918 (-) 792 WP_063675624.1 phosphatidate cytidylyltransferase -
  Bt4C1_RS18700 (Bt4C1_18705) uppS 3716936..3717712 (-) 777 WP_000971296.1 isoprenyl transferase -
  Bt4C1_RS18705 (Bt4C1_18710) frr 3717798..3718355 (-) 558 WP_000531505.1 ribosome recycling factor -
  Bt4C1_RS18710 (Bt4C1_18715) pyrH 3718358..3719080 (-) 723 WP_000042669.1 UMP kinase -
  Bt4C1_RS18715 (Bt4C1_18720) tsf 3719147..3720034 (-) 888 WP_001018576.1 translation elongation factor Ts -
  Bt4C1_RS18720 (Bt4C1_18725) rpsB 3720138..3720839 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  Bt4C1_RS18725 (Bt4C1_18730) codY 3721187..3721966 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  Bt4C1_RS18730 (Bt4C1_18735) hslU 3722044..3723435 (-) 1392 WP_000550083.1 ATP-dependent protease ATPase subunit HslU -
  Bt4C1_RS18735 (Bt4C1_18740) hslV 3723458..3724000 (-) 543 WP_000526274.1 ATP-dependent protease proteolytic subunit HslV -
  Bt4C1_RS18740 (Bt4C1_18745) xerC 3724043..3724942 (-) 900 WP_001101245.1 tyrosine recombinase XerC -
  Bt4C1_RS18745 (Bt4C1_18750) trmFO 3725008..3726312 (-) 1305 WP_000213006.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  Bt4C1_RS18750 (Bt4C1_18755) topA 3726361..3728439 (-) 2079 WP_001286957.1 type I DNA topoisomerase -
  Bt4C1_RS18755 (Bt4C1_18760) dprA 3728584..3729453 (-) 870 WP_000818044.1 DNA-processing protein DprA -
  Bt4C1_RS18760 (Bt4C1_18765) sucD 3729542..3730444 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  Bt4C1_RS18765 (Bt4C1_18770) sucC 3730464..3731624 (-) 1161 WP_001020784.1 ADP-forming succinate--CoA ligase subunit beta -
  Bt4C1_RS18770 (Bt4C1_18775) - 3731818..3732591 (-) 774 WP_001171121.1 ribonuclease HII -
  Bt4C1_RS18775 (Bt4C1_18780) ylqF 3732648..3733538 (-) 891 WP_000236702.1 ribosome biogenesis GTPase YlqF -
  Bt4C1_RS18780 (Bt4C1_18785) lepB 3733559..3734110 (-) 552 WP_000711853.1 signal peptidase I -
  Bt4C1_RS18785 (Bt4C1_18790) rplS 3734212..3734556 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  Bt4C1_RS18790 (Bt4C1_18795) trmD 3734703..3735437 (-) 735 WP_000686901.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  Bt4C1_RS18795 (Bt4C1_18800) rimM 3735437..3735952 (-) 516 WP_000170272.1 ribosome maturation factor RimM -
  Bt4C1_RS18800 (Bt4C1_18805) - 3736073..3736300 (-) 228 WP_000737393.1 KH domain-containing protein -
  Bt4C1_RS18805 (Bt4C1_18810) rpsP 3736315..3736587 (-) 273 WP_000268748.1 30S ribosomal protein S16 -
  Bt4C1_RS18810 (Bt4C1_18815) ffh 3736689..3738038 (-) 1350 WP_000863460.1 signal recognition particle protein -
  Bt4C1_RS18815 (Bt4C1_18820) - 3738051..3738383 (-) 333 WP_000891062.1 putative DNA-binding protein -
  Bt4C1_RS18820 (Bt4C1_18825) ftsY 3738516..3739505 (-) 990 WP_000007640.1 signal recognition particle-docking protein FtsY -
  Bt4C1_RS18825 (Bt4C1_18830) smc 3739521..3743090 (-) 3570 WP_063675625.1 chromosome segregation protein SMC -
  Bt4C1_RS18830 (Bt4C1_18835) rncS 3743238..3743975 (-) 738 WP_001146875.1 ribonuclease III -
  Bt4C1_RS18835 (Bt4C1_18840) acpP 3744034..3744267 (-) 234 WP_000786062.1 acyl carrier protein -
  Bt4C1_RS18840 (Bt4C1_18845) fabG 3744337..3745077 (-) 741 WP_000911774.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  Bt4C1_RS18845 (Bt4C1_18850) fabD 3745077..3746021 (-) 945 WP_000515908.1 ACP S-malonyltransferase -
  Bt4C1_RS18850 (Bt4C1_18855) plsX 3746036..3747028 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  Bt4C1_RS18855 (Bt4C1_18860) fapR 3747025..3747618 (-) 594 WP_000747349.1 transcription factor FapR -
  Bt4C1_RS18860 (Bt4C1_18865) recG 3747706..3749754 (-) 2049 WP_001000822.1 ATP-dependent DNA helicase RecG -
  Bt4C1_RS18865 (Bt4C1_18870) - 3750045..3751721 (-) 1677 WP_000027134.1 DAK2 domain-containing protein -
  Bt4C1_RS18870 (Bt4C1_18875) - 3751744..3752106 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  Bt4C1_RS18875 (Bt4C1_18880) rpmB 3752483..3752671 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  Bt4C1_RS18880 (Bt4C1_18885) spoVM 3752744..3752824 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  Bt4C1_RS18885 (Bt4C1_18890) - 3752891..3753571 (-) 681 WP_000752665.1 thiamine diphosphokinase -
  Bt4C1_RS18890 (Bt4C1_18895) rpe 3753641..3754285 (-) 645 WP_000589970.1 ribulose-phosphate 3-epimerase -
  Bt4C1_RS18895 (Bt4C1_18900) rsgA 3754288..3755169 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  Bt4C1_RS18900 (Bt4C1_18905) pknB 3755417..3757390 (-) 1974 WP_063675626.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=177317 Bt4C1_RS18725 WP_000421290.1 3721187..3721966(-) (codY) [Bacillus thuringiensis serovar alesti strain BGSC 4C1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=177317 Bt4C1_RS18725 WP_000421290.1 3721187..3721966(-) (codY) [Bacillus thuringiensis serovar alesti strain BGSC 4C1]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTGGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGTGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTAGGTCAAG
AGTTCTTAGATGACGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCACATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment