Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGB   Type   Machinery gene
Locus tag   B34_RS06335 Genome accession   NZ_CP014793
Coordinates   1147121..1148155 (-) Length   344 a.a.
NCBI ID   WP_011198115.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCDB 34     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1093452..1147056 1147121..1148155 flank 65


Gene organization within MGE regions


Location: 1093452..1148155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B34_RS05970 (B34_01210) - 1093452..1094141 (+) 690 WP_080624021.1 hypothetical protein -
  B34_RS05975 (B34_01211) - 1094308..1095048 (+) 741 WP_080624022.1 helix-turn-helix domain-containing protein -
  B34_RS05980 (B34_01212) - 1095148..1096212 (-) 1065 WP_080624023.1 hypothetical protein -
  B34_RS05985 (B34_01213) - 1096238..1096564 (-) 327 WP_080624024.1 hypothetical protein -
  B34_RS05990 (B34_01214) - 1096838..1097695 (+) 858 WP_080624025.1 SMI1/KNR4 family protein -
  B34_RS05995 (B34_01215) - 1097775..1098635 (+) 861 WP_016886590.1 HNH endonuclease -
  B34_RS23985 - 1098675..1098944 (-) 270 Protein_1206 peptidoglycan-binding domain-containing protein -
  B34_RS23990 (B34_01216) - 1099035..1099748 (-) 714 Protein_1207 N-acetylmuramoyl-L-alanine amidase -
  B34_RS06005 (B34_01217) - 1099800..1100063 (-) 264 WP_080624027.1 phage holin -
  B34_RS06010 (B34_01218) - 1100079..1100348 (-) 270 WP_020450984.1 hemolysin XhlA family protein -
  B34_RS06015 (B34_01219) - 1100428..1101261 (-) 834 WP_080624028.1 hypothetical protein -
  B34_RS06020 (B34_01220) - 1101363..1101545 (-) 183 WP_043929126.1 XkdX family protein -
  B34_RS06025 (B34_01221) - 1101542..1101871 (-) 330 WP_044822060.1 XkdW family protein -
  B34_RS06030 (B34_01222) - 1101883..1102986 (-) 1104 WP_080624029.1 hypothetical protein -
  B34_RS06035 (B34_01223) - 1102987..1103262 (-) 276 WP_080624030.1 hypothetical protein -
  B34_RS06040 (B34_01224) - 1103259..1103837 (-) 579 WP_080624031.1 YmfQ family protein -
  B34_RS06045 (B34_01225) - 1103824..1104867 (-) 1044 WP_080624032.1 baseplate J/gp47 family protein -
  B34_RS06050 (B34_01226) - 1104860..1105285 (-) 426 WP_076793407.1 DUF2634 domain-containing protein -
  B34_RS06055 (B34_01227) - 1105298..1105606 (-) 309 WP_016886601.1 DUF2577 domain-containing protein -
  B34_RS06060 (B34_01228) - 1105603..1106586 (-) 984 WP_080624033.1 XkdQ/YqbQ family protein -
  B34_RS06065 (B34_01229) - 1106608..1107267 (-) 660 WP_080624034.1 LysM peptidoglycan-binding domain-containing protein -
  B34_RS06070 (B34_01230) - 1107260..1112524 (-) 5265 WP_080624035.1 transglycosylase SLT domain-containing protein -
  B34_RS23490 (B34_01231) - 1112528..1112677 (-) 150 WP_096748223.1 hypothetical protein -
  B34_RS06075 (B34_01232) - 1112707..1113156 (-) 450 WP_080624036.1 phage tail assembly chaperone -
  B34_RS24480 (B34_01233) - 1113332..1113499 (+) 168 WP_418202194.1 hypothetical protein -
  B34_RS23995 - 1113904..1113954 (+) 51 WP_231124463.1 hypothetical protein -
  B34_RS06090 (B34_01234) - 1114227..1114670 (-) 444 WP_080624039.1 phage tail tube protein -
  B34_RS06095 (B34_01235) - 1114672..1116072 (-) 1401 WP_080624040.1 phage tail sheath family protein -
  B34_RS06100 - 1116073..1116300 (-) 228 WP_080624041.1 hypothetical protein -
  B34_RS06105 (B34_01236) - 1116301..1116741 (-) 441 WP_231124464.1 phage tail terminator family protein -
  B34_RS06110 (B34_01237) - 1116755..1117252 (-) 498 WP_080624043.1 HK97 gp10 family phage protein -
  B34_RS06115 (B34_01238) - 1117249..1117605 (-) 357 WP_080624044.1 YqbH/XkdH family protein -
  B34_RS06120 (B34_01239) - 1117602..1117997 (-) 396 WP_080624045.1 DUF3199 family protein -
  B34_RS06125 (B34_01240) - 1118004..1118417 (-) 414 WP_080624046.1 YqbF domain-containing protein -
  B34_RS06130 (B34_01241) - 1118428..1119363 (-) 936 WP_080624047.1 phage major capsid protein -
  B34_RS06135 (B34_01242) - 1119376..1120551 (-) 1176 WP_080624048.1 XkdF-like putative serine protease domain-containing protein -
  B34_RS06140 (B34_01243) - 1120557..1121429 (-) 873 WP_080624049.1 hypothetical protein -
  B34_RS06145 (B34_01244) - 1121478..1122395 (-) 918 WP_080624050.1 phage minor head protein -
  B34_RS06150 (B34_01245) - 1122388..1123926 (-) 1539 WP_080624051.1 phage portal protein -
  B34_RS06155 (B34_01246) - 1123930..1125225 (-) 1296 WP_080624052.1 PBSX family phage terminase large subunit -
  B34_RS06160 (B34_01247) terS 1125222..1126091 (-) 870 WP_080624053.1 phage terminase small subunit -
  B34_RS06165 (B34_01248) - 1126278..1126568 (-) 291 WP_080624054.1 hypothetical protein -
  B34_RS06170 (B34_01249) - 1126859..1127062 (-) 204 WP_080624055.1 hypothetical protein -
  B34_RS06180 (B34_01251) - 1127566..1128030 (-) 465 WP_196775411.1 SMI1/KNR4 family protein -
  B34_RS06185 (B34_01252) - 1128051..1129928 (-) 1878 WP_080624056.1 T7SS effector LXG polymorphic toxin -
  B34_RS06190 (B34_01253) - 1130210..1131313 (+) 1104 WP_096748224.1 Rap family tetratricopeptide repeat protein -
  B34_RS24315 (B34_01254) - 1131313..1131447 (+) 135 WP_257475243.1 hypothetical protein -
  B34_RS06195 (B34_01255) - 1131494..1131877 (-) 384 WP_080624058.1 ArpU family phage packaging/lysis transcriptional regulator -
  B34_RS06200 (B34_01257) - 1131968..1132621 (-) 654 WP_080624059.1 hypothetical protein -
  B34_RS06205 (B34_01258) - 1132618..1132818 (-) 201 WP_080624060.1 XtrA/YqaO family protein -
  B34_RS24000 - 1132837..1132977 (-) 141 WP_231124459.1 hypothetical protein -
  B34_RS06215 (B34_01260) - 1133145..1133702 (+) 558 WP_080624062.1 GNAT family N-acetyltransferase -
  B34_RS06220 (B34_01261) - 1133695..1133901 (-) 207 WP_080624231.1 XtrA/YqaO family protein -
  B34_RS06225 (B34_01262) - 1133975..1134241 (-) 267 WP_080624063.1 ASCH/PUA domain-containing protein -
  B34_RS06230 (B34_01264) - 1134484..1135161 (-) 678 WP_167511159.1 hypothetical protein -
  B34_RS06235 (B34_01265) - 1135131..1135589 (-) 459 WP_080624064.1 RusA family crossover junction endodeoxyribonuclease -
  B34_RS06240 (B34_01267) - 1135726..1135986 (-) 261 WP_080624065.1 IDEAL domain-containing protein -
  B34_RS06245 (B34_01268) - 1136094..1136288 (-) 195 WP_231124460.1 Fur-regulated basic protein FbpA -
  B34_RS06250 (B34_01269) dnaB 1136306..1137610 (-) 1305 WP_080624066.1 replicative DNA helicase -
  B34_RS06255 (B34_01270) - 1137585..1137866 (-) 282 WP_080624067.1 replicative helicase loader/inhibitor -
  B34_RS06260 (B34_01271) - 1137869..1138681 (-) 813 WP_080624068.1 hypothetical protein -
  B34_RS06265 (B34_01273) recT 1138849..1139799 (-) 951 WP_080624069.1 recombination protein RecT -
  B34_RS06270 (B34_01274) - 1139792..1140742 (-) 951 WP_080624070.1 YqaJ viral recombinase family protein -
  B34_RS06275 (B34_01275) - 1140742..1140921 (-) 180 WP_017474946.1 hypothetical protein -
  B34_RS06280 (B34_01276) - 1141042..1141254 (-) 213 WP_080624071.1 YqaI family protein -
  B34_RS06285 (B34_01277) - 1141267..1141461 (-) 195 WP_080624072.1 hypothetical protein -
  B34_RS06290 (B34_01278) - 1141589..1141777 (-) 189 WP_080624073.1 hypothetical protein -
  B34_RS06295 (B34_01279) - 1141778..1142044 (-) 267 WP_080624074.1 hypothetical protein -
  B34_RS06300 (B34_01280) - 1142041..1142568 (-) 528 WP_080624075.1 helix-turn-helix domain-containing protein -
  B34_RS06310 (B34_01282) - 1142867..1143070 (-) 204 WP_080624077.1 helix-turn-helix domain-containing protein -
  B34_RS06315 (B34_01283) - 1143194..1143616 (+) 423 WP_231124461.1 helix-turn-helix domain-containing protein -
  B34_RS06320 (B34_01284) - 1143812..1144312 (+) 501 WP_080624078.1 ImmA/IrrE family metallo-endopeptidase -
  B34_RS06325 (B34_01285) - 1144305..1145477 (+) 1173 WP_080624079.1 hypothetical protein -
  B34_RS06330 (B34_01286) - 1145524..1147056 (+) 1533 WP_167511160.1 recombinase family protein -
  B34_RS06335 (B34_01287) comGB 1147121..1148155 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene

Sequence

Protein


Download         Length: 344 a.a.        Molecular weight: 39737.95 Da        Isoelectric Point: 9.3543

>NTDB_id=174158 B34_RS06335 WP_011198115.1 1147121..1148155(-) (comGB) [Bacillus licheniformis strain SCDB 34]
MKIKMKWPVREQADLLKKLGDMMQSGYTILDALSMLKLQLNERRRADLTFAMEKLTEGCPVFQVLEMISFHKDAVTIVYF
AEQHGNLPFAFRQSGELLHRKIAQSEKLKKAARYPLFLVLTVCVIISIMKSAIVPQFSAIYESMNVETSFATTLIFYVFD
HFYLFFAGLPLVAAALSLYYLCSFRHKPPEDKMAFLITIPLLGQTFKLFNSYFLSLQLSNLLQAGLSVYDSLKAFESQPF
LRFHKNEAKRLIERLKQGESLEQMLAGHPFYENDLAKAVAHGQLNGHLYRELYSYSQFLIERLERKAEKWTGLIQPLIYG
LTAAMILILYLSMLLPMYQMMNQL

Nucleotide


Download         Length: 1035 bp        

>NTDB_id=174158 B34_RS06335 WP_011198115.1 1147121..1148155(-) (comGB) [Bacillus licheniformis strain SCDB 34]
ATGAAGATTAAAATGAAGTGGCCTGTCCGGGAACAGGCGGACCTTCTGAAAAAACTAGGAGACATGATGCAGAGTGGCTA
TACGATTTTGGATGCTTTAAGTATGCTGAAATTGCAATTGAATGAAAGACGAAGAGCGGATCTGACATTTGCGATGGAGA
AGCTGACAGAAGGGTGTCCTGTGTTTCAAGTTCTTGAAATGATTTCCTTTCACAAGGATGCTGTCACCATTGTTTACTTT
GCCGAACAGCACGGGAATTTGCCATTTGCCTTTAGGCAGAGCGGAGAGCTGCTTCACCGCAAGATCGCTCAAAGCGAAAA
ATTAAAGAAAGCCGCCAGATACCCCTTGTTTTTAGTTTTAACGGTCTGCGTCATCATCTCTATTATGAAATCAGCAATAG
TTCCGCAATTTTCCGCCATCTATGAATCGATGAACGTTGAAACGTCTTTTGCAACGACTCTCATCTTTTATGTTTTCGAT
CACTTTTATCTTTTTTTCGCGGGACTGCCGCTGGTTGCCGCAGCTCTATCCCTCTATTATCTGTGTTCATTCCGCCATAA
ACCTCCAGAAGACAAAATGGCCTTTCTCATTACAATTCCCTTGCTGGGCCAAACCTTCAAACTATTCAACAGCTATTTTT
TATCGCTCCAGCTGAGCAATCTTTTGCAAGCGGGTCTGTCTGTATATGACAGTTTAAAAGCATTTGAAAGCCAGCCGTTT
TTACGATTTCATAAAAATGAAGCGAAGCGCTTGATCGAGCGGCTGAAACAGGGGGAGAGTCTGGAGCAGATGCTGGCCGG
ACATCCGTTTTATGAAAATGATTTAGCAAAGGCTGTTGCACACGGCCAACTAAATGGGCACTTATACAGAGAGCTGTATT
CATATAGTCAGTTTTTGATTGAGCGGCTTGAAAGAAAGGCCGAAAAATGGACAGGCCTGATCCAGCCATTGATTTACGGG
CTAACCGCGGCGATGATATTAATTCTTTATTTGTCCATGCTTTTGCCAATGTATCAAATGATGAACCAGCTATAA

Domains

Predicted by InterproScan.

Type II secretion system (T2SS), protein F (T2SSF)

(16-135)

Type II secretion system (T2SS), protein F (T2SSF)

(216-336)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGB Bacillus subtilis subsp. subtilis str. 168

56.656

93.895

0.532

Multiple sequence alignment