Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FORC21_RS19570 Genome accession   NZ_CP014486
Coordinates   3706042..3706821 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain FORC021     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3680749..3742507 3706042..3706821 within 0


Gene organization within MGE regions


Location: 3680749..3742507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC21_RS19460 (FORC21_3664) - 3681319..3682218 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  FORC21_RS19465 (FORC21_3665) pnp 3682370..3684508 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  FORC21_RS19470 (FORC21_3666) rpsO 3684669..3684938 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FORC21_RS19475 (FORC21_3667) ribF 3685039..3686010 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  FORC21_RS19480 (FORC21_3668) truB 3686054..3686977 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  FORC21_RS19485 (FORC21_3669) rbfA 3687064..3687420 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  FORC21_RS19490 (FORC21_3670) - 3687436..3687717 (-) 282 WP_000582363.1 DUF503 family protein -
  FORC21_RS19495 (FORC21_3671) infB 3687714..3689774 (-) 2061 WP_065382194.1 translation initiation factor IF-2 -
  FORC21_RS19500 (FORC21_3672) - 3689779..3690090 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FORC21_RS19505 (FORC21_3673) - 3690091..3690363 (-) 273 WP_000071127.1 YlxR family protein -
  FORC21_RS19510 (FORC21_3674) nusA 3690375..3691481 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  FORC21_RS19515 (FORC21_3675) rimP 3691499..3691969 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  FORC21_RS19520 (FORC21_3676) - 3692306..3696607 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  FORC21_RS19525 (FORC21_3677) - 3696732..3698432 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  FORC21_RS19530 (FORC21_3678) rseP 3698542..3699798 (-) 1257 WP_001090244.1 RIP metalloprotease RseP -
  FORC21_RS19535 (FORC21_3679) dxr 3699816..3700958 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FORC21_RS19540 (FORC21_3680) cdsA 3700982..3701773 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  FORC21_RS19545 (FORC21_3681) uppS 3701791..3702567 (-) 777 WP_000971296.1 isoprenyl transferase -
  FORC21_RS19550 (FORC21_3682) frr 3702653..3703210 (-) 558 WP_000531501.1 ribosome recycling factor -
  FORC21_RS19555 (FORC21_3683) pyrH 3703213..3703935 (-) 723 WP_000042668.1 UMP kinase -
  FORC21_RS19560 (FORC21_3684) tsf 3704002..3704889 (-) 888 WP_001018578.1 translation elongation factor Ts -
  FORC21_RS19565 (FORC21_3685) rpsB 3704993..3705694 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  FORC21_RS19570 (FORC21_3686) codY 3706042..3706821 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FORC21_RS19575 (FORC21_3687) hslU 3706899..3708290 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  FORC21_RS19580 (FORC21_3688) hslV 3708313..3708855 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FORC21_RS19585 (FORC21_3689) xerC 3708898..3709797 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  FORC21_RS19590 (FORC21_3690) trmFO 3709863..3711167 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FORC21_RS19595 (FORC21_3691) topA 3711216..3713294 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  FORC21_RS19600 (FORC21_3692) dprA 3713439..3714308 (-) 870 WP_000818059.1 DNA-processing protein DprA -
  FORC21_RS19605 (FORC21_3693) sucD 3714397..3715299 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FORC21_RS19610 (FORC21_3694) sucC 3715319..3716479 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  FORC21_RS19615 (FORC21_3695) - 3716674..3717447 (-) 774 WP_001194265.1 ribonuclease HII -
  FORC21_RS19620 (FORC21_3696) ylqF 3717504..3718394 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  FORC21_RS19625 (FORC21_3697) lepB 3718415..3718966 (-) 552 WP_000711853.1 signal peptidase I -
  FORC21_RS19630 (FORC21_3698) rplS 3719068..3719412 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FORC21_RS19635 trmD 3719559..3720292 (-) 734 Protein_3684 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FORC21_RS19640 (FORC21_3701) rimM 3720292..3720807 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  FORC21_RS19645 (FORC21_3702) - 3720929..3721156 (-) 228 WP_000737401.1 KH domain-containing protein -
  FORC21_RS19650 (FORC21_3703) rpsP 3721171..3721443 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FORC21_RS19655 (FORC21_3704) ffh 3721545..3722894 (-) 1350 WP_000863460.1 signal recognition particle protein -
  FORC21_RS19660 (FORC21_3705) - 3722907..3723239 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FORC21_RS19665 (FORC21_3706) ftsY 3723373..3724362 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  FORC21_RS19670 (FORC21_3707) smc 3724378..3727947 (-) 3570 WP_000478978.1 chromosome segregation protein SMC -
  FORC21_RS19675 (FORC21_3708) rncS 3728094..3728831 (-) 738 WP_001146875.1 ribonuclease III -
  FORC21_RS19680 (FORC21_3709) acpP 3728890..3729123 (-) 234 WP_000786062.1 acyl carrier protein -
  FORC21_RS19685 (FORC21_3710) fabG 3729193..3729933 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FORC21_RS19690 (FORC21_3711) fabD 3729933..3730877 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  FORC21_RS19695 (FORC21_3712) plsX 3730892..3731884 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  FORC21_RS19700 (FORC21_3713) fapR 3731881..3732474 (-) 594 WP_000747348.1 transcription factor FapR -
  FORC21_RS19705 (FORC21_3714) recG 3732563..3734611 (-) 2049 WP_065212076.1 ATP-dependent DNA helicase RecG -
  FORC21_RS19710 (FORC21_3715) - 3734902..3736578 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  FORC21_RS19715 (FORC21_3716) - 3736601..3736963 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FORC21_RS19720 (FORC21_3717) rpmB 3737340..3737528 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FORC21_RS19725 spoVM 3737602..3737682 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FORC21_RS19730 (FORC21_3718) - 3737749..3738429 (-) 681 WP_000752665.1 thiamine diphosphokinase -
  FORC21_RS19735 (FORC21_3719) rpe 3738499..3739143 (-) 645 WP_065212077.1 ribulose-phosphate 3-epimerase -
  FORC21_RS19740 (FORC21_3720) rsgA 3739146..3740027 (-) 882 WP_065212078.1 ribosome small subunit-dependent GTPase A -
  FORC21_RS19745 (FORC21_3721) pknB 3740274..3742247 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=171900 FORC21_RS19570 WP_000421290.1 3706042..3706821(-) (codY) [Bacillus cereus strain FORC021]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=171900 FORC21_RS19570 WP_000421290.1 3706042..3706821(-) (codY) [Bacillus cereus strain FORC021]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment