Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FORC24_RS19205 Genome accession   NZ_CP012691
Coordinates   3839721..3840500 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain FORC_024     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3814449..3876185 3839721..3840500 within 0


Gene organization within MGE regions


Location: 3814449..3876185
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC24_RS19095 (FORC24_3607) - 3815019..3815918 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  FORC24_RS19100 (FORC24_3608) pnp 3816070..3818208 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  FORC24_RS19105 (FORC24_3609) rpsO 3818369..3818638 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FORC24_RS19110 (FORC24_3610) ribF 3818739..3819710 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  FORC24_RS19115 (FORC24_3611) truB 3819754..3820677 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  FORC24_RS19120 (FORC24_3612) rbfA 3820764..3821120 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  FORC24_RS19125 (FORC24_3613) - 3821136..3821417 (-) 282 WP_000582363.1 DUF503 family protein -
  FORC24_RS19130 (FORC24_3614) infB 3821414..3823474 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  FORC24_RS19135 (FORC24_3615) - 3823479..3823790 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FORC24_RS19140 (FORC24_3616) - 3823791..3824063 (-) 273 WP_000071127.1 YlxR family protein -
  FORC24_RS19145 (FORC24_3617) nusA 3824075..3825181 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  FORC24_RS19150 (FORC24_3618) rimP 3825199..3825669 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  FORC24_RS19155 (FORC24_3619) - 3826006..3830307 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  FORC24_RS19160 (FORC24_3620) - 3830432..3832132 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  FORC24_RS19165 (FORC24_3621) rseP 3832242..3833498 (-) 1257 WP_001090244.1 RIP metalloprotease RseP -
  FORC24_RS19170 (FORC24_3622) dxr 3833516..3834658 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FORC24_RS19175 (FORC24_3623) cdsA 3834682..3835473 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  FORC24_RS19180 (FORC24_3624) uppS 3835491..3836267 (-) 777 WP_000971296.1 isoprenyl transferase -
  FORC24_RS19185 (FORC24_3625) frr 3836353..3836910 (-) 558 WP_000531501.1 ribosome recycling factor -
  FORC24_RS19190 (FORC24_3626) pyrH 3836913..3837635 (-) 723 WP_000042668.1 UMP kinase -
  FORC24_RS19195 (FORC24_3627) tsf 3837702..3838589 (-) 888 WP_001018578.1 translation elongation factor Ts -
  FORC24_RS19200 (FORC24_3628) rpsB 3838672..3839373 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  FORC24_RS19205 (FORC24_3629) codY 3839721..3840500 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FORC24_RS19210 (FORC24_3630) hslU 3840578..3841969 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  FORC24_RS19215 (FORC24_3631) hslV 3841992..3842534 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FORC24_RS19220 (FORC24_3632) xerC 3842577..3843476 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  FORC24_RS19225 (FORC24_3633) trmFO 3843542..3844846 (-) 1305 WP_000213003.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FORC24_RS19230 (FORC24_3634) topA 3844895..3846973 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  FORC24_RS19235 (FORC24_3635) dprA 3847118..3847987 (-) 870 WP_000818061.1 DNA-processing protein DprA -
  FORC24_RS19240 (FORC24_3636) sucD 3848076..3848978 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FORC24_RS19245 (FORC24_3637) sucC 3848998..3850158 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  FORC24_RS19250 (FORC24_3638) - 3850353..3851126 (-) 774 WP_001194265.1 ribonuclease HII -
  FORC24_RS19255 (FORC24_3639) ylqF 3851183..3852073 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  FORC24_RS19260 (FORC24_3640) lepB 3852094..3852645 (-) 552 WP_000711853.1 signal peptidase I -
  FORC24_RS19265 (FORC24_3641) rplS 3852747..3853091 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FORC24_RS19270 (FORC24_3642) trmD 3853238..3853972 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FORC24_RS19275 (FORC24_3643) rimM 3853972..3854487 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  FORC24_RS19280 (FORC24_3644) - 3854609..3854836 (-) 228 WP_000737401.1 KH domain-containing protein -
  FORC24_RS19285 (FORC24_3645) rpsP 3854851..3855123 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FORC24_RS19290 (FORC24_3646) ffh 3855224..3856573 (-) 1350 WP_000863460.1 signal recognition particle protein -
  FORC24_RS19295 (FORC24_3647) - 3856586..3856918 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FORC24_RS19300 (FORC24_3648) ftsY 3857052..3858041 (-) 990 WP_000007659.1 signal recognition particle-docking protein FtsY -
  FORC24_RS19305 (FORC24_3649) smc 3858057..3861626 (-) 3570 WP_000478978.1 chromosome segregation protein SMC -
  FORC24_RS19310 (FORC24_3650) rncS 3861773..3862510 (-) 738 WP_001146875.1 ribonuclease III -
  FORC24_RS19315 (FORC24_3651) acpP 3862569..3862802 (-) 234 WP_000786062.1 acyl carrier protein -
  FORC24_RS19320 (FORC24_3652) fabG 3862872..3863612 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FORC24_RS19325 (FORC24_3653) fabD 3863612..3864556 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  FORC24_RS19330 (FORC24_3654) plsX 3864571..3865563 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  FORC24_RS19335 (FORC24_3655) fapR 3865560..3866153 (-) 594 WP_000747348.1 transcription factor FapR -
  FORC24_RS19340 (FORC24_3656) recG 3866242..3868290 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  FORC24_RS19345 (FORC24_3657) - 3868581..3870257 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  FORC24_RS19350 (FORC24_3658) - 3870280..3870642 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FORC24_RS19355 (FORC24_3659) rpmB 3871019..3871207 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FORC24_RS19360 spoVM 3871281..3871361 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FORC24_RS19365 (FORC24_3660) - 3871428..3872108 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  FORC24_RS19370 (FORC24_3661) rpe 3872177..3872821 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  FORC24_RS19375 (FORC24_3662) rsgA 3872824..3873705 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  FORC24_RS19380 (FORC24_3663) pknB 3873952..3875925 (-) 1974 WP_000904732.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=156490 FORC24_RS19205 WP_000421290.1 3839721..3840500(-) (codY) [Bacillus cereus strain FORC_024]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=156490 FORC24_RS19205 WP_000421290.1 3839721..3840500(-) (codY) [Bacillus cereus strain FORC_024]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment