Detailed information    

insolico Bioinformatically predicted

Overview


Name   proC   Type   Machinery gene
Locus tag   AEI23_RS05975 Genome accession   NZ_CP012221
Coordinates   1095497..1096228 (+) Length   243 a.a.
NCBI ID   WP_002873292.1    Uniprot ID   A0AAX2LXC4
Organism   Campylobacter jejuni strain CJ018CCUA     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1052527..1094947 1095497..1096228 flank 550


Gene organization within MGE regions


Location: 1052527..1096228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AEI23_RS05645 (AEI23_05670) - 1052527..1053615 (+) 1089 WP_052786483.1 CinA family protein -
  AEI23_RS05650 (AEI23_05675) - 1053627..1054053 (+) 427 Protein_1106 GNAT family N-acetyltransferase -
  AEI23_RS05655 (AEI23_05680) - 1054117..1054568 (+) 452 Protein_1107 nitroreductase family protein -
  AEI23_RS05660 (AEI23_05685) rdxA 1054568..1055173 (+) 606 WP_052786485.1 NAD(P)H-dependent oxidoreductase -
  AEI23_RS05665 (AEI23_05690) - 1055381..1056184 (-) 804 WP_002870227.1 S24 family peptidase -
  AEI23_RS05670 (AEI23_05695) - 1056283..1056552 (+) 270 WP_002876361.1 hypothetical protein -
  AEI23_RS05675 (AEI23_05700) - 1056568..1056759 (+) 192 WP_002870225.1 hypothetical protein -
  AEI23_RS05680 (AEI23_05705) - 1056760..1058874 (+) 2115 WP_115766822.1 Mu transposase C-terminal domain-containing protein -
  AEI23_RS05685 (AEI23_05710) - 1058963..1059820 (+) 858 WP_052784313.1 AAA family ATPase -
  AEI23_RS05690 (AEI23_05715) - 1059817..1060008 (+) 192 WP_069360446.1 sigma factor-like helix-turn-helix DNA-binding protein -
  AEI23_RS05695 (AEI23_05720) - 1060005..1060190 (+) 186 WP_002824157.1 hypothetical protein -
  AEI23_RS05700 (AEI23_05725) - 1060246..1060677 (+) 432 WP_002865075.1 SA1788 family PVL leukocidin-associated protein -
  AEI23_RS05705 (AEI23_05730) - 1060751..1061089 (+) 339 WP_043020465.1 DUF4406 domain-containing protein -
  AEI23_RS05715 (AEI23_05740) - 1061285..1061770 (+) 486 WP_002806832.1 host-nuclease inhibitor Gam family protein -
  AEI23_RS05720 (AEI23_05745) - 1061767..1061946 (+) 180 WP_002791416.1 hypothetical protein -
  AEI23_RS05725 (AEI23_05750) - 1062010..1062282 (+) 273 WP_002791414.1 hypothetical protein -
  AEI23_RS05730 (AEI23_05755) - 1062279..1062665 (+) 387 WP_002791413.1 YopX family protein -
  AEI23_RS05735 (AEI23_05760) - 1062780..1062959 (+) 180 WP_002864977.1 hypothetical protein -
  AEI23_RS05740 (AEI23_05765) - 1062956..1063384 (+) 429 WP_002790255.1 hypothetical protein -
  AEI23_RS05745 (AEI23_05770) - 1063436..1063627 (+) 192 WP_002918730.1 hypothetical protein -
  AEI23_RS05750 (AEI23_05775) - 1063614..1064093 (+) 480 WP_002918728.1 phage virion morphogenesis protein -
  AEI23_RS05755 (AEI23_05780) - 1064232..1065365 (-) 1134 WP_002870187.1 phage minor head protein -
  AEI23_RS05760 (AEI23_05785) - 1065358..1066740 (-) 1383 WP_002870186.1 DUF935 family protein -
  AEI23_RS05765 (AEI23_05790) terL 1066737..1068263 (-) 1527 WP_002865465.1 phage terminase large subunit -
  AEI23_RS05770 (AEI23_05795) - 1068353..1068667 (-) 315 WP_002790261.1 phage holin family protein -
  AEI23_RS05775 (AEI23_05800) - 1068779..1069027 (-) 249 WP_002784496.1 hypothetical protein -
  AEI23_RS05780 (AEI23_05805) - 1069024..1069365 (-) 342 WP_002854893.1 hypothetical protein -
  AEI23_RS05785 (AEI23_05810) - 1069376..1069765 (-) 390 WP_002870185.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  AEI23_RS05790 (AEI23_05815) - 1069755..1070120 (-) 366 WP_002790266.1 hypothetical protein -
  AEI23_RS05795 (AEI23_05820) - 1070117..1070470 (-) 354 WP_002790896.1 hypothetical protein -
  AEI23_RS05800 (AEI23_05825) - 1070467..1070694 (-) 228 WP_002875630.1 hypothetical protein -
  AEI23_RS05805 (AEI23_05830) - 1070694..1071581 (-) 888 WP_002790002.1 Mu-like prophage major head subunit gpT family protein -
  AEI23_RS05810 (AEI23_05835) - 1071581..1072621 (-) 1041 WP_052802992.1 phage protease -
  AEI23_RS05815 (AEI23_05840) - 1072752..1073216 (+) 465 WP_002865847.1 DUF1804 family protein -
  AEI23_RS05820 (AEI23_05845) - 1073213..1073845 (+) 633 WP_002795236.1 phage baseplate assembly protein V -
  AEI23_RS05825 (AEI23_05850) - 1073854..1074045 (+) 192 WP_002873733.1 hypothetical protein -
  AEI23_RS05830 (AEI23_05855) - 1074042..1074332 (+) 291 WP_002795239.1 GPW/gp25 family protein -
  AEI23_RS05835 (AEI23_05860) - 1074329..1075495 (+) 1167 WP_115766823.1 baseplate J/gp47 family protein -
  AEI23_RS05840 (AEI23_05865) - 1075593..1076213 (+) 621 WP_002864870.1 phage tail protein I -
  AEI23_RS05845 (AEI23_05870) - 1076213..1077292 (+) 1080 WP_002903449.1 phage tail protein -
  AEI23_RS05850 (AEI23_05875) - 1077302..1077808 (+) 507 WP_002903450.1 DUF4376 domain-containing protein -
  AEI23_RS05855 (AEI23_05880) - 1077805..1078176 (+) 372 WP_061563589.1 DUF1353 domain-containing protein -
  AEI23_RS05860 (AEI23_05885) - 1078277..1079290 (+) 1014 WP_115766824.1 hypothetical protein -
  AEI23_RS05865 (AEI23_05890) - 1079309..1080499 (+) 1191 WP_115766825.1 phage tail sheath family protein -
  AEI23_RS05870 (AEI23_05895) - 1080622..1081137 (+) 516 WP_002865794.1 phage major tail tube protein -
  AEI23_RS05875 (AEI23_05900) - 1081148..1081384 (+) 237 WP_002789979.1 phage tail assembly protein -
  AEI23_RS09825 - 1081368..1081505 (+) 138 WP_002865793.1 hypothetical protein -
  AEI23_RS05880 (AEI23_05905) - 1081492..1081722 (-) 231 WP_002870149.1 hypothetical protein -
  AEI23_RS05885 (AEI23_05910) - 1081752..1083716 (+) 1965 WP_002876455.1 phage tail tape measure protein -
  AEI23_RS05890 (AEI23_05915) - 1083718..1084092 (+) 375 WP_002789966.1 phage tail protein -
  AEI23_RS05895 (AEI23_05920) - 1084085..1084276 (+) 192 WP_002789964.1 tail protein X -
  AEI23_RS05900 (AEI23_05925) - 1084270..1085238 (+) 969 WP_002865687.1 phage tail protein -
  AEI23_RS05905 (AEI23_05930) - 1085340..1086155 (+) 816 WP_002888079.1 DNA adenine methylase -
  AEI23_RS05910 (AEI23_05935) - 1086185..1086472 (-) 288 WP_002865266.1 hypothetical protein -
  AEI23_RS05915 (AEI23_05940) - 1086552..1086746 (-) 195 WP_002843339.1 hypothetical protein -
  AEI23_RS05920 (AEI23_05945) - 1086756..1087076 (-) 321 WP_002865000.1 hypothetical protein -
  AEI23_RS05925 (AEI23_05950) - 1087157..1087786 (-) 630 WP_115766826.1 LexA family transcriptional regulator -
  AEI23_RS05930 (AEI23_05955) pgsA 1088072..1088608 (+) 537 WP_052786486.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  AEI23_RS05935 (AEI23_05960) rseP 1088605..1089711 (+) 1107 WP_052786487.1 RIP metalloprotease RseP -
  AEI23_RS05940 (AEI23_05965) - 1089704..1090554 (+) 851 Protein_1164 VirK family antimicrobial peptide resistance protein -
  AEI23_RS05945 (AEI23_05970) rpsF 1090641..1091018 (+) 378 WP_002812868.1 30S ribosomal protein S6 -
  AEI23_RS05950 (AEI23_05975) ssb 1091027..1091578 (+) 552 WP_002856575.1 single-stranded DNA-binding protein -
  AEI23_RS05955 (AEI23_05980) rpsR 1091589..1091849 (+) 261 WP_002853032.1 30S ribosomal protein S18 -
  AEI23_RS05960 (AEI23_05985) lon 1091908..1094283 (-) 2376 WP_002878791.1 endopeptidase La -
  AEI23_RS05965 (AEI23_05990) - 1094300..1094947 (-) 648 WP_002860191.1 outer membrane protein assembly factor BamD -
  AEI23_RS05970 (AEI23_05995) fliW 1095108..1095497 (+) 390 WP_002852982.1 flagellar assembly protein FliW -
  AEI23_RS05975 (AEI23_06000) proC 1095497..1096228 (+) 732 WP_002873292.1 pyrroline-5-carboxylate reductase Machinery gene

Sequence


Protein


Download         Length: 243 a.a.        Molecular weight: 26608.01 Da        Isoelectric Point: 8.5934

>NTDB_id=152508 AEI23_RS05975 WP_002873292.1 1095497..1096228(+) (proC) [Campylobacter jejuni strain CJ018CCUA]
MLYILANGSMATALAYGLKDDYEICIVGRSIEKLQALTKEGFKTLLYKDFNIEGKDVILAFKPYALENIAQMLKGQARIL
ISVLANVDFEKLQTIKAQNYVRIMPNTAAKYKASTTPYILKNSHFENEILDILKTFGSAYKLDNEIQMNAAMAISGCAPA
FLALIAESIANAGVYEGLSKELSLNLTRSLFKSSSALLEHEHPAIIKENICSPGGVTIKGIKILEQKGIRGSFFEAINAS
SAK

Nucleotide


Download         Length: 732 bp        

>NTDB_id=152508 AEI23_RS05975 WP_002873292.1 1095497..1096228(+) (proC) [Campylobacter jejuni strain CJ018CCUA]
ATGCTCTATATACTTGCAAATGGATCTATGGCAACAGCCTTAGCCTATGGATTAAAAGATGATTATGAAATTTGTATAGT
AGGAAGAAGTATAGAAAAACTTCAAGCCCTCACCAAAGAAGGCTTTAAAACCTTACTTTACAAAGATTTTAACATAGAAG
GTAAAGATGTTATTTTGGCTTTCAAACCTTATGCTTTAGAAAATATTGCCCAAATGCTAAAAGGACAAGCACGCATCTTA
ATCTCTGTTTTAGCCAATGTTGATTTTGAAAAACTACAAACCATCAAAGCTCAAAATTATGTTAGAATAATGCCTAATAC
AGCAGCTAAATACAAGGCTTCAACCACACCATATATACTTAAAAACTCTCATTTTGAAAATGAAATTTTAGACATTTTAA
AAACTTTTGGCTCGGCTTATAAATTAGATAATGAAATACAAATGAATGCAGCTATGGCGATTAGCGGCTGCGCTCCTGCT
TTTTTAGCACTTATAGCAGAAAGCATTGCTAATGCTGGAGTTTATGAAGGTTTGTCAAAAGAACTTAGTCTCAATCTTAC
GCGCTCTTTATTTAAAAGCTCTAGTGCTTTACTAGAACATGAACATCCAGCTATTATCAAAGAAAATATTTGCTCCCCTG
GCGGAGTTACAATAAAAGGCATAAAAATACTCGAACAAAAAGGAATTCGCGGAAGTTTTTTTGAAGCCATAAATGCTAGC
AGCGCTAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  proC Campylobacter jejuni subsp. jejuni 81-176

98.765

100

0.988


Multiple sequence alignment