Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   B14_RS09080 Genome accession   NZ_CP014842
Coordinates   1762094..1762465 (+) Length   123 a.a.
NCBI ID   WP_003183461.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCDB 14     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1757094..1767465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B14_RS09040 (B14_01810) - 1757284..1757661 (+) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  B14_RS09050 (B14_01812) - 1757903..1758742 (+) 840 WP_003183480.1 STAS domain-containing protein -
  B14_RS09055 (B14_01813) comGA 1758899..1759963 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  B14_RS09060 (B14_01814) comGB 1759953..1760987 (+) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  B14_RS09065 (B14_01815) comGC 1761001..1761294 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  B14_RS09070 (B14_01816) comGD 1761300..1761737 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  B14_RS09075 comGE 1761721..1762068 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  B14_RS09080 (B14_01817) comGF 1762094..1762465 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  B14_RS09085 (B14_01818) comGG 1762478..1762843 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  B14_RS09090 (B14_01819) - 1762932..1763114 (+) 183 WP_003183456.1 YqzE family protein -
  B14_RS09095 (B14_01820) - 1763138..1763458 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  B14_RS09100 (B14_01821) tapA 1763735..1764463 (+) 729 WP_080623590.1 amyloid fiber anchoring/assembly protein TapA -
  B14_RS09105 (B14_01822) sipW 1764460..1765044 (+) 585 WP_003183449.1 signal peptidase I SipW -
  B14_RS09110 (B14_01823) tasA 1765118..1765912 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  B14_RS09115 (B14_01824) sinR 1766017..1766352 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  B14_RS09120 (B14_01825) sinI 1766386..1766562 (-) 177 WP_003183444.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 123 a.a.        Molecular weight: 14179.31 Da        Isoelectric Point: 10.3094

>NTDB_id=150331 B14_RS09080 WP_003183461.1 1762094..1762465(+) (comGF) [Bacillus licheniformis strain SCDB 14]
MFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKRVNG
KGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 372 bp        

>NTDB_id=150331 B14_RS09080 WP_003183461.1 1762094..1762465(+) (comGF) [Bacillus licheniformis strain SCDB 14]
ATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATATTCACCCCCG
TGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTGATCATCAGT
CACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGGGTCAATGGA
AAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCTTGAAGCGAC
AAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA

Domains

Predicted by InterProScan.

Putative Competence protein ComGF (ComGF)

(19-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

98.374

0.382

Multiple sequence alignment