Detailed information    

insolico Bioinformatically predicted

Overview

Name   comD   Type   Machinery gene
Locus tag   ASU2_RS06175 Genome accession   NC_018690
Coordinates   1351145..1351549 (-) Length   134 a.a.
NCBI ID   WP_014991935.1    Uniprot ID   K0FY07
Organism   Actinobacillus suis H91-0380     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1352072..1365591 1351145..1351549 flank 523


Gene organization within MGE regions


Location: 1351145..1365591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ASU2_RS06175 (ASU2_06120) comD 1351145..1351549 (-) 405 WP_014991935.1 hypothetical protein Machinery gene
  ASU2_RS06180 (ASU2_06125) comC 1351542..1352069 (-) 528 WP_014991936.1 hypothetical protein Machinery gene
  ASU2_RS06185 (ASU2_06130) comB 1352072..1352593 (-) 522 WP_014991937.1 hypothetical protein Machinery gene
  ASU2_RS06190 (ASU2_06135) comA 1352575..1353261 (-) 687 WP_014991938.1 hypothetical protein Machinery gene
  ASU2_RS06195 (ASU2_06140) - 1353400..1355985 (+) 2586 WP_014991939.1 penicillin-binding protein 1A -
  ASU2_RS06200 (ASU2_06145) aroK 1356249..1356770 (+) 522 WP_005623982.1 shikimate kinase AroK -
  ASU2_RS06205 (ASU2_06150) aroB 1356787..1357875 (+) 1089 WP_014991940.1 3-dehydroquinate synthase -
  ASU2_RS06210 (ASU2_06155) - 1357879..1358715 (+) 837 WP_014991941.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  ASU2_RS06215 (ASU2_06160) - 1358785..1360143 (+) 1359 WP_014991942.1 sodium-dependent transporter -
  ASU2_RS06220 (ASU2_06165) pgi 1360271..1361911 (-) 1641 WP_014991943.1 glucose-6-phosphate isomerase -
  ASU2_RS06225 (ASU2_06170) ubiK 1361950..1362201 (-) 252 WP_014991944.1 ubiquinone biosynthesis accessory factor UbiK -
  ASU2_RS06250 (ASU2_06175) aroE 1362916..1363740 (-) 825 WP_014991945.1 shikimate dehydrogenase -
  ASU2_RS06255 (ASU2_06180) - 1363746..1364300 (-) 555 WP_014991946.1 Sua5/YciO/YrdC/YwlC family protein -
  ASU2_RS06260 (ASU2_06185) - 1364293..1364826 (-) 534 WP_014991947.1 DNA topoisomerase family protein -
  ASU2_RS06265 (ASU2_06190) yqfB 1364826..1365131 (-) 306 WP_014991948.1 N(4)-acetylcytidine aminohydrolase -
  ASU2_RS06270 (ASU2_06195) recX 1365124..1365579 (-) 456 WP_014991949.1 recombination regulator RecX -

Sequence

Protein


Download         Length: 134 a.a.        Molecular weight: 15544.88 Da        Isoelectric Point: 4.8722

>NTDB_id=1464 ASU2_RS06175 WP_014991935.1 1351145..1351549(-) (comD) [Actinobacillus suis H91-0380]
MSKYILILLFFSSISSADPFYGEKLDDENSTFSPESEIAINTENLTACNLPSQRNSRYLPAKLAQLKFIGVLKKQDKYKA
IFMDTQKQLFDLQVNDWLDNELIQIVDIDLKSISYIHWQTEKNCQFPTLITLKL

Nucleotide


Download         Length: 405 bp        

>NTDB_id=1464 ASU2_RS06175 WP_014991935.1 1351145..1351549(-) (comD) [Actinobacillus suis H91-0380]
ATGAGTAAATATATTTTGATTTTATTATTTTTCTCATCAATAAGTAGTGCAGACCCGTTTTATGGAGAGAAATTAGACGA
TGAAAATAGTACATTTTCTCCTGAATCAGAGATTGCAATAAATACAGAAAATTTAACCGCTTGTAACTTACCGTCACAAC
GAAATTCCCGCTATTTGCCGGCAAAATTGGCACAGCTAAAATTTATCGGAGTACTGAAAAAACAGGATAAATATAAAGCG
ATTTTTATGGATACGCAAAAGCAACTGTTTGATCTACAAGTGAATGATTGGCTAGATAATGAGTTGATTCAGATCGTAGA
TATTGATTTAAAATCAATTAGTTATATACATTGGCAAACAGAGAAAAATTGTCAATTTCCGACTTTAATTACCTTAAAGT
TATAG

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB K0FY07

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value