Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB3   Type   Machinery gene
Locus tag   AA971_RS01965 Genome accession   NZ_CP011482
Coordinates   401772..402035 (+) Length   87 a.a.
NCBI ID   WP_064432017.1    Uniprot ID   -
Organism   Helicobacter pylori strain L7     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 399239..439006 401772..402035 within 0


Gene organization within MGE regions


Location: 399239..439006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA971_RS01950 (AA971_01950) - 400109..400897 (+) 789 WP_154815414.1 integrase -
  AA971_RS01955 (AA971_01955) - 401001..401480 (+) 480 WP_064432015.1 hypothetical protein -
  AA971_RS01960 (AA971_01960) comB2 401477..401761 (+) 285 WP_064432016.1 TrbC/VirB2 family protein Machinery gene
  AA971_RS01965 (AA971_01965) comB3 401772..402035 (+) 264 WP_064432017.1 hypothetical protein Machinery gene
  AA971_RS01970 (AA971_01970) - 402047..402283 (+) 237 WP_064432018.1 hypothetical protein -
  AA971_RS01975 (AA971_01975) - 402283..403307 (+) 1025 Protein_389 transporter -
  AA971_RS01980 (AA971_01980) - 403310..404365 (+) 1056 Protein_390 helicase -
  AA971_RS01985 (AA971_01985) - 404498..404707 (+) 210 WP_000462384.1 hypothetical protein -
  AA971_RS01990 (AA971_01990) - 404704..404955 (+) 252 WP_064432020.1 hypothetical protein -
  AA971_RS01995 (AA971_01995) - 405006..405407 (+) 402 WP_180598596.1 hypothetical protein -
  AA971_RS02000 (AA971_02000) - 405420..407480 (+) 2061 WP_064432021.1 type IA DNA topoisomerase -
  AA971_RS02005 (AA971_02005) - 407532..408002 (+) 471 WP_000965788.1 hypothetical protein -
  AA971_RS02010 (AA971_02010) - 407972..408772 (+) 801 WP_064432022.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  AA971_RS02015 (AA971_02015) - 408846..409511 (-) 666 WP_064432023.1 hypothetical protein -
  AA971_RS02020 (AA971_02020) - 409489..409866 (-) 378 WP_000365702.1 hypothetical protein -
  AA971_RS02025 (AA971_02025) - 409913..410581 (-) 669 WP_064432024.1 ParA family protein -
  AA971_RS08425 - 411216..411380 (+) 165 WP_000189763.1 hypothetical protein -
  AA971_RS02030 (AA971_02030) - 411381..412436 (+) 1056 WP_064432025.1 ArdC family protein -
  AA971_RS08000 - 414269..415702 (+) 1434 WP_080471558.1 hypothetical protein -
  AA971_RS02040 (AA971_02040) - 415699..416949 (+) 1251 WP_064432026.1 P-type conjugative transfer protein TrbL -
  AA971_RS02045 (AA971_02045) - 416946..418091 (+) 1146 WP_412767745.1 hypothetical protein -
  AA971_RS02050 (AA971_02050) - 418225..418953 (-) 729 WP_064432027.1 hypothetical protein -
  AA971_RS02055 (AA971_02055) ctkA 419185..420162 (+) 978 WP_064432028.1 serine/threonine-protein kinase CtkA -
  AA971_RS02060 (AA971_02060) - 420476..421543 (-) 1068 WP_064432029.1 tyrosine-type recombinase/integrase -
  AA971_RS02065 (AA971_02065) - 422699..424629 (-) 1931 Protein_408 relaxase/mobilization nuclease domain-containing protein -
  AA971_RS02070 (AA971_02070) - 425540..426349 (-) 810 Protein_409 N-6 DNA methylase -
  AA971_RS02075 (AA971_02075) - 426342..428630 (-) 2289 WP_230381426.1 DEAD/DEAH box helicase family protein -
  AA971_RS08565 - 428647..428820 (+) 174 WP_230381427.1 hypothetical protein -
  AA971_RS08570 - 428804..429501 (-) 698 Protein_412 type I restriction endonuclease -
  AA971_RS02080 (AA971_02080) - 429549..431444 (-) 1896 WP_064432030.1 motility associated factor glycosyltransferase family protein -
  AA971_RS02085 (AA971_02085) - 431482..432237 (-) 756 WP_064432031.1 TerB family tellurite resistance protein -
  AA971_RS02090 (AA971_02090) - 432247..432561 (-) 315 WP_014536090.1 hypothetical protein -
  AA971_RS02095 (AA971_02095) - 432563..434050 (-) 1488 WP_064432032.1 DUF5644 domain-containing protein -
  AA971_RS02100 (AA971_02100) - 434062..434550 (-) 489 WP_064432033.1 hypothetical protein -
  AA971_RS02105 (AA971_02105) - 434535..436271 (-) 1737 WP_064432034.1 M3 family oligoendopeptidase -
  AA971_RS02110 (AA971_02110) - 436369..437619 (-) 1251 WP_064432035.1 cation:proton antiporter -
  AA971_RS08575 - 437772..437954 (-) 183 WP_080471473.1 hypothetical protein -
  AA971_RS02115 (AA971_02115) - 437938..438498 (-) 561 WP_000595776.1 outer membrane beta-barrel protein -
  AA971_RS08745 - 438542..438702 (-) 161 Protein_422 orotate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 87 a.a.        Molecular weight: 9972.87 Da        Isoelectric Point: 5.7206

>NTDB_id=146199 AA971_RS01965 WP_064432017.1 401772..402035(+) (comB3) [Helicobacter pylori strain L7]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFVPFIMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KANSFYA

Nucleotide


Download         Length: 264 bp        

>NTDB_id=146199 AA971_RS01965 WP_064432017.1 401772..402035(+) (comB3) [Helicobacter pylori strain L7]
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGTTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAGAG
CTTTTTAATCGCAGGATTTGTGCCTTTTATTATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB3 Helicobacter pylori 26695

59.77

100

0.598

Multiple sequence alignment