Detailed information
Overview
| Name | comGE | Type | Machinery gene |
| Locus tag | RM31_RS07610 | Genome accession | NZ_CP010298 |
| Coordinates | 1654032..1654331 (-) | Length | 99 a.a. |
| NCBI ID | WP_000844413.1 | Uniprot ID | X5E258 |
| Organism | Staphylococcus aureus strain ATCC BAA1680 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1630938..1657083 | 1654032..1654331 | within | 0 |
Gene organization within MGE regions
Location: 1630938..1657083
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RM31_RS07480 (RM31_08055) | - | 1630938..1631474 (-) | 537 | WP_077442703.1 | IS30 family transposase | - |
| RM31_RS07485 (RM31_08060) | - | 1631455..1631958 (-) | 504 | WP_000746375.1 | transposase | - |
| RM31_RS07490 (RM31_08065) | - | 1632067..1632423 (-) | 357 | WP_001255379.1 | cystatin-like fold lipoprotein | - |
| RM31_RS07495 (RM31_08070) | - | 1632479..1633069 (-) | 591 | WP_000810443.1 | hypothetical protein | - |
| RM31_RS07500 (RM31_08075) | - | 1633076..1634122 (-) | 1047 | WP_000247465.1 | CHAP domain-containing protein | - |
| RM31_RS07505 (RM31_08080) | - | 1634112..1635959 (-) | 1848 | WP_000681154.1 | CD3337/EF1877 family mobilome membrane protein | - |
| RM31_RS07510 (RM31_08085) | - | 1635964..1637322 (-) | 1359 | WP_001251211.1 | FtsK/SpoIIIE domain-containing protein | - |
| RM31_RS07515 (RM31_08090) | - | 1637376..1639871 (-) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| RM31_RS07520 (RM31_08095) | - | 1639906..1640289 (-) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| RM31_RS07525 (RM31_08100) | - | 1640301..1640561 (-) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| RM31_RS07530 (RM31_08105) | - | 1640566..1641621 (-) | 1056 | WP_000692003.1 | conjugal transfer protein | - |
| RM31_RS07535 (RM31_08110) | - | 1641682..1642773 (-) | 1092 | WP_000172939.1 | replication initiation factor domain-containing protein | - |
| RM31_RS07540 (RM31_08115) | - | 1642948..1643250 (-) | 303 | WP_000386891.1 | hypothetical protein | - |
| RM31_RS07545 (RM31_08120) | - | 1643264..1643584 (-) | 321 | WP_000805733.1 | DUF961 family protein | - |
| RM31_RS07550 (RM31_08125) | - | 1643735..1644019 (-) | 285 | WP_000134545.1 | hypothetical protein | - |
| RM31_RS07555 (RM31_08130) | efp | 1644414..1644971 (-) | 558 | WP_000626504.1 | elongation factor P | - |
| RM31_RS07560 (RM31_08135) | - | 1644997..1646058 (-) | 1062 | WP_000087107.1 | M24 family metallopeptidase | - |
| RM31_RS07565 (RM31_08140) | - | 1646163..1646744 (+) | 582 | WP_000737686.1 | hypothetical protein | - |
| RM31_RS07570 (RM31_08145) | - | 1646758..1646976 (+) | 219 | WP_001244298.1 | SA1362 family protein | - |
| RM31_RS07575 (RM31_08150) | - | 1647040..1647870 (-) | 831 | WP_000141108.1 | biotin/lipoate A/B protein ligase family protein | - |
| RM31_RS07580 (RM31_08155) | - | 1648028..1648414 (+) | 387 | WP_001276571.1 | rhodanese-like domain-containing protein | - |
| RM31_RS07585 (RM31_08160) | gcvPB | 1648779..1650251 (-) | 1473 | WP_000202189.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| RM31_RS07590 (RM31_08165) | gcvPA | 1650244..1651590 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| RM31_RS07595 (RM31_08170) | gcvT | 1651610..1652701 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RM31_RS07600 (RM31_08175) | - | 1652860..1653384 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| RM31_RS14420 (RM31_08180) | - | 1653374..1653520 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| RM31_RS07605 (RM31_08185) | comGF | 1653617..1654114 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| RM31_RS07610 (RM31_08190) | comGE | 1654032..1654331 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| RM31_RS07615 (RM31_08195) | comGD | 1654318..1654764 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| RM31_RS07620 (RM31_08200) | comGC | 1654742..1655053 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| RM31_RS07625 (RM31_08205) | comGB | 1655067..1656137 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| RM31_RS07630 (RM31_08210) | comGA | 1656109..1657083 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 99 a.a. Molecular weight: 11093.20 Da Isoelectric Point: 9.9215
>NTDB_id=135981 RM31_RS07610 WP_000844413.1 1654032..1654331(-) (comGE) [Staphylococcus aureus strain ATCC BAA1680]
MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYDIKQSDQ
QICAISKNTTSYQKTCIQY
MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYDIKQSDQ
QICAISKNTTSYQKTCIQY
Nucleotide
Download Length: 300 bp
>NTDB_id=135981 RM31_RS07610 WP_000844413.1 1654032..1654331(-) (comGE) [Staphylococcus aureus strain ATCC BAA1680]
ATGAAAAGCTATAAGTGTAAAGGTTCATTCTTAATAGATAGTATGGCTGGATTTTTGCTAATTGGATTGATTACATTACT
ATTGATACCAATGATGAATCAAATGCAAGCGAGTATAAACCATAAACTACAAACAATTGATGCTTCTAAAGTAATTTTGA
CGACTGTATCTAAAATTAATAAAGAAGAACTTAAGAAGGGGGTAACTATAGGGAAGTATGATATTAAGCAAAGTGACCAA
CAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTATTAA
ATGAAAAGCTATAAGTGTAAAGGTTCATTCTTAATAGATAGTATGGCTGGATTTTTGCTAATTGGATTGATTACATTACT
ATTGATACCAATGATGAATCAAATGCAAGCGAGTATAAACCATAAACTACAAACAATTGATGCTTCTAAAGTAATTTTGA
CGACTGTATCTAAAATTAATAAAGAAGAACTTAAGAAGGGGGTAACTATAGGGAAGTATGATATTAAGCAAAGTGACCAA
CAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTATTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGE | Staphylococcus aureus MW2 |
86.842 |
100 |
1 |
| comGE | Staphylococcus aureus N315 |
98.99 |
100 |
0.99 |