Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SpyM6D471_RS00675 Genome accession   NZ_CP011415
Coordinates   106698..106982 (+) Length   94 a.a.
NCBI ID   WP_027968839.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain D471     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 101698..111982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SpyM6D471_RS00650 (SpyM6D471_00650) - 103644..104009 (+) 366 WP_002986560.1 DUF1033 family protein -
  SpyM6D471_RS00655 (SpyM6D471_00655) comGA 104102..105040 (+) 939 WP_002986557.1 competence type IV pilus ATPase ComGA Machinery gene
  SpyM6D471_RS00660 (SpyM6D471_00660) comGB 104976..106010 (+) 1035 WP_011184088.1 competence type IV pilus assembly protein ComGB Machinery gene
  SpyM6D471_RS00665 (SpyM6D471_00665) comGC 106012..106338 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SpyM6D471_RS00670 (SpyM6D471_00670) comGD 106313..106741 (+) 429 WP_011184089.1 competence type IV pilus minor pilin ComGD Machinery gene
  SpyM6D471_RS00675 (SpyM6D471_00675) comGE 106698..106982 (+) 285 WP_027968839.1 competence type IV pilus minor pilin ComGE Machinery gene
  SpyM6D471_RS00680 (SpyM6D471_00680) comGF 106975..107409 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  SpyM6D471_RS00685 (SpyM6D471_00685) comGG 107393..107719 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  SpyM6D471_RS00690 (SpyM6D471_00690) comGH 107817..108770 (+) 954 WP_021340467.1 class I SAM-dependent methyltransferase Machinery gene
  SpyM6D471_RS00695 (SpyM6D471_00695) - 108829..110025 (+) 1197 WP_002986533.1 acetate kinase -
  SpyM6D471_RS00700 (SpyM6D471_00700) - 110212..110520 (+) 309 WP_011017251.1 hypothetical protein -
  SpyM6D471_RS00705 (SpyM6D471_00705) proC 110603..111373 (-) 771 WP_011184092.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10617.54 Da        Isoelectric Point: 8.0182

>NTDB_id=127986 SpyM6D471_RS00675 WP_027968839.1 106698..106982(+) (comGE) [Streptococcus pyogenes strain D471]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDTY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=127986 SpyM6D471_RS00675 WP_027968839.1 106698..106982(+) (comGE) [Streptococcus pyogenes strain D471]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATACATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment