Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VU19_RS00655 Genome accession   NZ_CP011068
Coordinates   104041..104325 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain STAB10015     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99041..109325
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VU19_RS00630 (VU19_00630) - 100987..101352 (+) 366 WP_002986560.1 DUF1033 family protein -
  VU19_RS00635 (VU19_00635) comGA 101445..102383 (+) 939 WP_011284420.1 competence type IV pilus ATPase ComGA Machinery gene
  VU19_RS00640 (VU19_00640) comGB 102319..103353 (+) 1035 WP_227868694.1 competence type IV pilus assembly protein ComGB Machinery gene
  VU19_RS00645 (VU19_00645) comGC 103355..103681 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  VU19_RS00650 (VU19_00650) comGD 103656..104084 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VU19_RS00655 (VU19_00655) comGE 104041..104325 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  VU19_RS00660 (VU19_00660) comGF 104318..104752 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  VU19_RS00665 (VU19_00665) comGG 104736..105062 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  VU19_RS00670 (VU19_00670) comGH 105160..106113 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  VU19_RS00675 (VU19_00675) - 106172..107368 (+) 1197 WP_011284424.1 acetate kinase -
  VU19_RS00680 (VU19_00680) - 107555..107863 (+) 309 WP_011284425.1 hypothetical protein -
  VU19_RS00685 (VU19_00685) proC 107946..108716 (-) 771 WP_011284426.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=125918 VU19_RS00655 WP_011284422.1 104041..104325(+) (comGE) [Streptococcus pyogenes strain STAB10015]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=125918 VU19_RS00655 WP_011284422.1 104041..104325(+) (comGE) [Streptococcus pyogenes strain STAB10015]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383