Detailed information    

insolico Bioinformatically predicted

Overview


Name   comYH   Type   Machinery gene
Locus tag   QOR62_RS01135 Genome accession   NZ_OX460940
Coordinates   190750..191724 (+) Length   324 a.a.
NCBI ID   WP_001008574.1    Uniprot ID   A0AAV3JGK6
Organism   Streptococcus agalactiae isolate MRI Z2-179     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 190965..241546 190750..191724 flank -759


Gene organization within MGE regions


Location: 190750..241546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QOR62_RS01135 comYH 190750..191724 (+) 975 WP_001008574.1 N-6 DNA methylase Machinery gene
  QOR62_RS01140 - 191756..192949 (+) 1194 WP_000047534.1 acetate kinase -
  QOR62_RS01145 - 193101..193307 (+) 207 WP_000798241.1 helix-turn-helix transcriptional regulator -
  QOR62_RS01150 - 193366..193503 (+) 138 WP_001865900.1 hypothetical protein -
  QOR62_RS01155 - 193544..193999 (+) 456 WP_000905673.1 hypothetical protein -
  QOR62_RS01160 - 194068..194733 (+) 666 WP_000008113.1 type II CAAX endopeptidase family protein -
  QOR62_RS01165 proC 194754..195524 (-) 771 WP_001865901.1 pyrroline-5-carboxylate reductase -
  QOR62_RS01170 pepA 195594..196661 (-) 1068 WP_001281323.1 glutamyl aminopeptidase -
  QOR62_RS01175 - 196846..197085 (-) 240 WP_000660180.1 hypothetical protein -
  QOR62_RS01180 - 197246..197530 (+) 285 WP_000791272.1 DUF4651 domain-containing protein -
  QOR62_RS01185 - 197527..197850 (+) 324 WP_000602781.1 thioredoxin family protein -
  QOR62_RS01190 ytpR 197883..198509 (+) 627 WP_000578328.1 YtpR family tRNA-binding protein -
  QOR62_RS01195 - 198563..199279 (-) 717 WP_000186185.1 class I SAM-dependent methyltransferase -
  QOR62_RS01200 ssbA 199360..199755 (+) 396 WP_000282447.1 single-stranded DNA-binding protein Machinery gene
  QOR62_RS01205 - 199879..200523 (+) 645 WP_000416612.1 HAD family hydrolase -
  QOR62_RS01210 - 200550..202295 (+) 1746 WP_000930334.1 LytS/YhcK type 5TM receptor domain-containing protein -
  QOR62_RS01215 - 202276..203016 (+) 741 WP_000697630.1 LytTR family transcriptional regulator DNA-binding domain-containing protein -
  QOR62_RS01220 - 203186..203641 (+) 456 WP_000683316.1 CidA/LrgA family protein -
  QOR62_RS01225 lrgB 203643..204371 (+) 729 WP_000421726.1 antiholin-like protein LrgB -
  QOR62_RS01230 - 204614..206242 (+) 1629 WP_000170504.1 ABC transporter substrate-binding protein -
  QOR62_RS01235 - 206355..207332 (+) 978 WP_000680645.1 ABC transporter permease -
  QOR62_RS01240 - 207329..208150 (+) 822 WP_000603397.1 ABC transporter permease -
  QOR62_RS01245 - 208162..208965 (+) 804 WP_000140984.1 ABC transporter ATP-binding protein -
  QOR62_RS01250 - 208949..209575 (+) 627 WP_000171311.1 ABC transporter ATP-binding protein -
  QOR62_RS01255 treP 209858..211888 (+) 2031 WP_000434616.1 PTS system trehalose-specific EIIBC component -
  QOR62_RS01260 treC 212110..213735 (+) 1626 WP_000151017.1 alpha,alpha-phosphotrehalase -
  QOR62_RS01265 - 213951..215987 (+) 2037 WP_000228180.1 BglG family transcription antiterminator -
  QOR62_RS01270 - 215990..216274 (+) 285 WP_000944235.1 PTS sugar transporter subunit IIB -
  QOR62_RS01275 - 216287..217642 (+) 1356 WP_000677351.1 PTS ascorbate transporter subunit IIC -
  QOR62_RS01280 - 217645..218502 (+) 858 WP_000203489.1 transketolase -
  QOR62_RS01285 - 218499..219428 (+) 930 WP_001203821.1 transketolase C-terminal domain-containing protein -
  QOR62_RS01290 - 219537..220796 (+) 1260 WP_001203071.1 ferric reductase-like transmembrane domain-containing protein -
  QOR62_RS01295 rpsO 220884..221153 (+) 270 WP_001018249.1 30S ribosomal protein S15 -
  QOR62_RS01300 pnp 221534..223663 (+) 2130 WP_000043850.1 polyribonucleotide nucleotidyltransferase -
  QOR62_RS01305 - 223665..224417 (+) 753 WP_000204782.1 SseB family protein -
  QOR62_RS01310 cysE 224426..225010 (+) 585 WP_000539954.1 serine O-acetyltransferase -
  QOR62_RS01315 - 225020..225202 (+) 183 WP_000656476.1 lipoprotein -
  QOR62_RS01320 cysS 225199..226542 (+) 1344 WP_000591125.1 cysteine--tRNA ligase -
  QOR62_RS01325 - 226535..226921 (+) 387 WP_000568029.1 Mini-ribonuclease 3 -
  QOR62_RS01330 rlmB 227024..227779 (+) 756 WP_000178026.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  QOR62_RS01335 - 227776..228294 (+) 519 WP_000716636.1 NYN domain-containing protein -
  QOR62_RS01340 - 228387..229247 (+) 861 WP_000143135.1 DegV family protein -
  QOR62_RS01345 - 229784..229903 (+) 120 Protein_209 helix-turn-helix domain-containing protein -
  QOR62_RS01350 rplM 230128..230574 (+) 447 WP_001865567.1 50S ribosomal protein L13 -
  QOR62_RS01355 rpsI 230595..230987 (+) 393 WP_000035940.1 30S ribosomal protein S9 -
  QOR62_RS01360 - 231115..232269 (-) 1155 WP_000022165.1 site-specific integrase -
  QOR62_RS01365 - 232333..232923 (-) 591 WP_000181098.1 helix-turn-helix transcriptional regulator -
  QOR62_RS01370 - 233078..233383 (+) 306 WP_000331954.1 hypothetical protein -
  QOR62_RS01375 - 233519..233797 (+) 279 WP_000134670.1 hypothetical protein -
  QOR62_RS01380 - 233808..234038 (+) 231 WP_000360142.1 hypothetical protein -
  QOR62_RS01385 - 234051..234377 (+) 327 WP_000384270.1 replication initiator protein A -
  QOR62_RS01390 - 234381..235010 (+) 630 WP_000591148.1 hypothetical protein -
  QOR62_RS01395 - 235346..236221 (+) 876 WP_000770113.1 hypothetical protein -
  QOR62_RS01400 - 236257..236691 (+) 435 WP_001220479.1 hypothetical protein -
  QOR62_RS01405 mobV 237007..238263 (+) 1257 WP_000122832.1 MobV family relaxase -
  QOR62_RS01410 - 238431..238901 (+) 471 WP_000130119.1 hypothetical protein -
  QOR62_RS01415 - 239206..239541 (-) 336 WP_000384858.1 type II toxin-antitoxin system RelE/ParE family toxin -
  QOR62_RS01420 - 239531..239818 (-) 288 WP_000255538.1 hypothetical protein -
  QOR62_RS01425 - 240221..241441 (-) 1221 WP_000156558.1 site-specific integrase -

Sequence


Protein


Download         Length: 324 a.a.        Molecular weight: 37046.02 Da        Isoelectric Point: 4.5224

>NTDB_id=1159071 QOR62_RS01135 WP_001008574.1 190750..191724(+) (comYH) [Streptococcus agalactiae isolate MRI Z2-179]
MNFEKIETAYELILENIQTIENQLKTHIYDALIEQNSYYLGSSCDLDMVVVNNQKLRQLDLSQEEWRRTFQFIFIKSAQT
EQLQANHQFTPDSIGFILLFLLEELTSQETVDVLEIGSGTGNLAQTLLNNSSKELNYMGIEVDDLLIDLSASIAEIIGSS
AQFIQEDAVRPQILKESDVIISDLPVGYYPNDGIAKRYAVSSSKEHTYAHHLLMEQSLKYLKKDGIAIFLAPENLLTSPQ
SDLLKEWLKGYADVIAVLTLPETIFGSRQNAKSIFVLKKQAEQKPETFVYPLTDLQNRENMANFIENFQKWSRENSHYSK
NMIK

Nucleotide


Download         Length: 975 bp        

>NTDB_id=1159071 QOR62_RS01135 WP_001008574.1 190750..191724(+) (comYH) [Streptococcus agalactiae isolate MRI Z2-179]
ATGAATTTTGAAAAAATTGAGACAGCCTATGAGCTGATTTTAGAAAATATCCAAACGATTGAGAACCAATTAAAAACTCA
TATTTATGATGCCTTAATTGAACAGAACTCTTATTACCTTGGTTCAAGTTGTGATTTAGATATGGTTGTGGTGAATAACC
AAAAATTACGTCAACTTGACTTAAGTCAAGAAGAATGGCGTCGCACTTTCCAGTTCATTTTTATCAAATCTGCGCAAACA
GAGCAATTACAAGCTAATCATCAGTTTACGCCAGATAGTATTGGTTTTATCTTGTTATTTCTTTTGGAAGAATTAACGAG
TCAAGAGACAGTGGATGTCTTGGAAATTGGAAGTGGAACTGGGAATTTAGCTCAGACTCTCCTCAATAACAGCTCGAAAG
AGTTAAATTATATGGGCATTGAAGTTGATGATCTTTTGATTGATCTATCAGCAAGCATTGCTGAAATTATAGGTTCTAGT
GCCCAATTTATCCAAGAGGATGCTGTTAGACCACAAATTTTGAAAGAAAGCGATGTAATCATTAGTGATTTACCAGTTGG
CTATTATCCTAATGATGGTATTGCTAAACGATATGCTGTATCAAGTTCTAAAGAGCACACCTATGCTCACCATCTATTGA
TGGAGCAATCTCTTAAATATTTGAAAAAAGATGGAATCGCTATATTTTTAGCACCCGAAAACCTTTTAACAAGTCCACAA
AGTGATTTGCTGAAGGAGTGGTTAAAAGGATATGCAGATGTCATTGCCGTTTTAACTCTACCAGAAACTATTTTTGGAAG
TCGTCAAAATGCGAAATCTATATTTGTTCTCAAGAAGCAAGCAGAACAAAAACCAGAAACCTTTGTATATCCGCTGACAG
ATTTGCAAAATCGTGAGAATATGGCAAACTTCATTGAAAATTTTCAAAAATGGAGCAGAGAAAATAGTCATTACTCAAAA
AATATGATAAAATAG

Domains


Predicted by InterproScan.

(70-303)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comYH Streptococcus mutans UA159

67.302

97.222

0.654

  comYH Streptococcus mutans UA140

67.302

97.222

0.654


Multiple sequence alignment