Detailed information
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | CS889_RS02520 | Genome accession | NZ_LT635477 |
| Coordinates | 505367..505651 (-) | Length | 94 a.a. |
| NCBI ID | WP_000413637.1 | Uniprot ID | A0AB72ZV75 |
| Organism | Helicobacter pylori isolate HE147/09 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 446997..528543 | 505367..505651 | within | 0 |
Gene organization within MGE regions
Location: 446997..528543
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS889_RS02265 | - | 447853..450996 (-) | 3144 | WP_089086719.1 | type I restriction endonuclease | - |
| CS889_RS02270 | - | 451044..452939 (-) | 1896 | WP_089086720.1 | motility associated factor glycosyltransferase family protein | - |
| CS889_RS02275 | - | 452964..453731 (-) | 768 | WP_089086721.1 | TerB family tellurite resistance protein | - |
| CS889_RS02280 | - | 453741..454055 (-) | 315 | WP_001878784.1 | hypothetical protein | - |
| CS889_RS02285 | - | 454057..455544 (-) | 1488 | WP_089086722.1 | DUF5644 domain-containing protein | - |
| CS889_RS02290 | - | 455556..456044 (-) | 489 | WP_089086723.1 | hypothetical protein | - |
| CS889_RS02295 | - | 456029..457765 (-) | 1737 | WP_089086724.1 | M3 family oligoendopeptidase | - |
| CS889_RS02300 | - | 457862..459112 (-) | 1251 | WP_000431942.1 | cation:proton antiporter | - |
| CS889_RS08415 | - | 459266..459448 (-) | 183 | Protein_440 | hypothetical protein | - |
| CS889_RS02310 | - | 459432..459992 (-) | 561 | WP_000595776.1 | outer membrane beta-barrel protein | - |
| CS889_RS02315 | modA | 460218..460958 (+) | 741 | WP_089086725.1 | molybdate ABC transporter substrate-binding protein | - |
| CS889_RS02320 | modB | 460981..461655 (+) | 675 | WP_000349430.1 | molybdate ABC transporter permease subunit | - |
| CS889_RS02325 | - | 461652..462449 (+) | 798 | WP_089086726.1 | ATP-binding cassette domain-containing protein | - |
| CS889_RS02330 | gltX | 462567..463958 (-) | 1392 | WP_089086727.1 | glutamate--tRNA ligase | - |
| CS889_RS02335 | hopJ | 464076..465188 (+) | 1113 | WP_089086728.1 | Hop family outer membrane protein HopJ/HopK | - |
| CS889_RS02340 | - | 465197..466834 (+) | 1638 | Protein_447 | TaqI-like C-terminal specificity domain-containing protein | - |
| CS889_RS02345 | - | 466800..467648 (+) | 849 | WP_089086729.1 | glycosyltransferase family 9 protein | - |
| CS889_RS02350 | typA | 467694..469493 (+) | 1800 | WP_000790195.1 | translational GTPase TypA | - |
| CS889_RS02355 | - | 469509..469906 (+) | 398 | Protein_450 | DNA adenine methylase | - |
| CS889_RS02360 | - | 470664..472697 (+) | 2034 | WP_089086730.1 | relaxase/mobilization nuclease domain-containing protein | - |
| CS889_RS02365 | - | 473850..474917 (+) | 1068 | Protein_452 | tyrosine-type recombinase/integrase | - |
| CS889_RS02370 | - | 475234..476037 (-) | 804 | WP_089086732.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS889_RS02375 | - | 476009..476260 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| CS889_RS02380 | - | 476392..477072 (-) | 681 | WP_001153463.1 | hypothetical protein | - |
| CS889_RS02385 | - | 477293..478306 (+) | 1014 | WP_089086733.1 | hypothetical protein | - |
| CS889_RS02390 | - | 478311..479587 (-) | 1277 | Protein_457 | hypothetical protein | - |
| CS889_RS02395 | - | 479584..480846 (-) | 1263 | WP_089086734.1 | type IV secretion system protein | - |
| CS889_RS02400 | - | 480843..482276 (-) | 1434 | WP_089086735.1 | hypothetical protein | - |
| CS889_RS02405 | - | 482286..484332 (-) | 2047 | Protein_460 | hypothetical protein | - |
| CS889_RS02410 | - | 484332..485384 (-) | 1053 | WP_089086736.1 | ArdC family protein | - |
| CS889_RS08290 | - | 485385..485549 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| CS889_RS02420 | - | 486187..486855 (+) | 669 | WP_089086737.1 | ParA family protein | - |
| CS889_RS02425 | - | 486902..487279 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| CS889_RS02430 | - | 487257..487922 (+) | 666 | WP_089086738.1 | hypothetical protein | - |
| CS889_RS02435 | - | 487996..488799 (-) | 804 | WP_089086739.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS889_RS02440 | - | 488769..489239 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| CS889_RS02445 | - | 489294..491354 (-) | 2061 | WP_001942503.1 | type IA DNA topoisomerase | - |
| CS889_RS02455 | - | 491375..493618 (-) | 2244 | Protein_469 | type IV secretory system conjugative DNA transfer family protein | - |
| CS889_RS02460 | - | 493615..493842 (-) | 228 | Protein_470 | replication regulatory RepB family protein | - |
| CS889_RS02465 | - | 493812..494696 (-) | 885 | WP_089086741.1 | ATPase, T2SS/T4P/T4SS family | - |
| CS889_RS02470 | - | 494701..494976 (-) | 276 | WP_089086742.1 | hypothetical protein | - |
| CS889_RS02475 | - | 494993..495955 (-) | 963 | WP_089086743.1 | hypothetical protein | - |
| CS889_RS02480 | - | 495968..498190 (-) | 2223 | WP_089086744.1 | RGS domain-containing GTPase-activating protein | - |
| CS889_RS02485 | comB10 | 498174..499379 (-) | 1206 | WP_089086745.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| CS889_RS02490 | - | 499376..501031 (-) | 1656 | WP_000617227.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| CS889_RS02495 | - | 501028..502164 (-) | 1137 | WP_089086746.1 | VirB8/TrbF family protein | - |
| CS889_RS08420 | - | 502157..502297 (-) | 141 | WP_000789928.1 | hypothetical protein | - |
| CS889_RS02505 | - | 502294..504844 (-) | 2551 | Protein_479 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| CS889_RS02510 | - | 504844..505080 (-) | 237 | WP_001168537.1 | hypothetical protein | - |
| CS889_RS02515 | comB3 | 505092..505355 (-) | 264 | WP_001177718.1 | hypothetical protein | Machinery gene |
| CS889_RS02520 | comB2 | 505367..505651 (-) | 285 | WP_000413637.1 | TrbC/VirB2 family protein | Machinery gene |
| CS889_RS02525 | - | 505639..506127 (-) | 489 | WP_089086747.1 | hypothetical protein | - |
| CS889_RS02530 | - | 506191..506349 (-) | 159 | WP_231899360.1 | hypothetical protein | - |
| CS889_RS02535 | - | 506352..507152 (-) | 801 | WP_089086748.1 | integrase | - |
| CS889_RS02540 | - | 507207..507743 (+) | 537 | Protein_486 | DNA adenine methylase | - |
| CS889_RS02545 | - | 507746..508369 (+) | 624 | WP_089086749.1 | GIY-YIG nuclease family protein | - |
| CS889_RS02550 | - | 508517..508879 (+) | 363 | Protein_488 | DNA cytosine methyltransferase | - |
| CS889_RS02555 | - | 509039..509983 (-) | 945 | WP_089086751.1 | catalase family peroxidase | - |
| CS889_RS02560 | hofC | 510270..511856 (+) | 1587 | WP_089086752.1 | outer membrane beta-barrel protein HofC | - |
| CS889_RS02565 | hofD | 511928..513325 (+) | 1398 | WP_089086753.1 | outer membrane beta-barrel protein HofD | - |
| CS889_RS02580 | - | 513643..516102 (+) | 2460 | WP_414842625.1 | DUF3519 domain-containing protein | - |
| CS889_RS02585 | - | 516112..516533 (+) | 422 | Protein_493 | hypothetical protein | - |
| CS889_RS02590 | - | 516530..517077 (+) | 548 | Protein_494 | hypothetical protein | - |
| CS889_RS02595 | - | 517317..518453 (-) | 1137 | WP_000461999.1 | potassium channel family protein | - |
| CS889_RS02605 | rpmB | 518640..518828 (-) | 189 | WP_001118998.1 | 50S ribosomal protein L28 | - |
| CS889_RS02610 | - | 518921..519760 (-) | 840 | WP_089086759.1 | HpaA family protein | - |
| CS889_RS02615 | mraY | 519891..520952 (+) | 1062 | WP_089087378.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| CS889_RS02620 | murD | 520954..522222 (+) | 1269 | WP_089086760.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| CS889_RS02625 | - | 522219..522479 (-) | 261 | WP_089086761.1 | DUF493 family protein | - |
| CS889_RS02630 | - | 522469..522777 (-) | 309 | WP_089086762.1 | hotdog domain-containing protein | - |
| CS889_RS02635 | - | 523010..524338 (+) | 1329 | WP_000526620.1 | sodium-dependent transporter | - |
| CS889_RS02640 | - | 524349..525677 (+) | 1329 | WP_089086763.1 | sodium-dependent transporter | - |
| CS889_RS02645 | - | 525692..526758 (+) | 1067 | Protein_504 | phospholipase A | - |
| CS889_RS02650 | dnaN | 526814..527938 (+) | 1125 | WP_089086764.1 | DNA polymerase III subunit beta | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10753.05 Da Isoelectric Point: 10.7837
>NTDB_id=1145871 CS889_RS02520 WP_000413637.1 505367..505651(-) (comB2) [Helicobacter pylori isolate HE147/09]
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=1145871 CS889_RS02520 WP_000413637.1 505367..505651(-) (comB2) [Helicobacter pylori isolate HE147/09]
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.778 |
95.745 |
0.553 |