Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB2   Type   Machinery gene
Locus tag   CS889_RS02520 Genome accession   NZ_LT635477
Coordinates   505367..505651 (-) Length   94 a.a.
NCBI ID   WP_000413637.1    Uniprot ID   A0AB72ZV75
Organism   Helicobacter pylori isolate HE147/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 446997..528543 505367..505651 within 0


Gene organization within MGE regions


Location: 446997..528543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS889_RS02265 - 447853..450996 (-) 3144 WP_089086719.1 type I restriction endonuclease -
  CS889_RS02270 - 451044..452939 (-) 1896 WP_089086720.1 motility associated factor glycosyltransferase family protein -
  CS889_RS02275 - 452964..453731 (-) 768 WP_089086721.1 TerB family tellurite resistance protein -
  CS889_RS02280 - 453741..454055 (-) 315 WP_001878784.1 hypothetical protein -
  CS889_RS02285 - 454057..455544 (-) 1488 WP_089086722.1 DUF5644 domain-containing protein -
  CS889_RS02290 - 455556..456044 (-) 489 WP_089086723.1 hypothetical protein -
  CS889_RS02295 - 456029..457765 (-) 1737 WP_089086724.1 M3 family oligoendopeptidase -
  CS889_RS02300 - 457862..459112 (-) 1251 WP_000431942.1 cation:proton antiporter -
  CS889_RS08415 - 459266..459448 (-) 183 Protein_440 hypothetical protein -
  CS889_RS02310 - 459432..459992 (-) 561 WP_000595776.1 outer membrane beta-barrel protein -
  CS889_RS02315 modA 460218..460958 (+) 741 WP_089086725.1 molybdate ABC transporter substrate-binding protein -
  CS889_RS02320 modB 460981..461655 (+) 675 WP_000349430.1 molybdate ABC transporter permease subunit -
  CS889_RS02325 - 461652..462449 (+) 798 WP_089086726.1 ATP-binding cassette domain-containing protein -
  CS889_RS02330 gltX 462567..463958 (-) 1392 WP_089086727.1 glutamate--tRNA ligase -
  CS889_RS02335 hopJ 464076..465188 (+) 1113 WP_089086728.1 Hop family outer membrane protein HopJ/HopK -
  CS889_RS02340 - 465197..466834 (+) 1638 Protein_447 TaqI-like C-terminal specificity domain-containing protein -
  CS889_RS02345 - 466800..467648 (+) 849 WP_089086729.1 glycosyltransferase family 9 protein -
  CS889_RS02350 typA 467694..469493 (+) 1800 WP_000790195.1 translational GTPase TypA -
  CS889_RS02355 - 469509..469906 (+) 398 Protein_450 DNA adenine methylase -
  CS889_RS02360 - 470664..472697 (+) 2034 WP_089086730.1 relaxase/mobilization nuclease domain-containing protein -
  CS889_RS02365 - 473850..474917 (+) 1068 Protein_452 tyrosine-type recombinase/integrase -
  CS889_RS02370 - 475234..476037 (-) 804 WP_089086732.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS889_RS02375 - 476009..476260 (-) 252 WP_000006537.1 hypothetical protein -
  CS889_RS02380 - 476392..477072 (-) 681 WP_001153463.1 hypothetical protein -
  CS889_RS02385 - 477293..478306 (+) 1014 WP_089086733.1 hypothetical protein -
  CS889_RS02390 - 478311..479587 (-) 1277 Protein_457 hypothetical protein -
  CS889_RS02395 - 479584..480846 (-) 1263 WP_089086734.1 type IV secretion system protein -
  CS889_RS02400 - 480843..482276 (-) 1434 WP_089086735.1 hypothetical protein -
  CS889_RS02405 - 482286..484332 (-) 2047 Protein_460 hypothetical protein -
  CS889_RS02410 - 484332..485384 (-) 1053 WP_089086736.1 ArdC family protein -
  CS889_RS08290 - 485385..485549 (-) 165 WP_000189763.1 hypothetical protein -
  CS889_RS02420 - 486187..486855 (+) 669 WP_089086737.1 ParA family protein -
  CS889_RS02425 - 486902..487279 (+) 378 WP_000365707.1 hypothetical protein -
  CS889_RS02430 - 487257..487922 (+) 666 WP_089086738.1 hypothetical protein -
  CS889_RS02435 - 487996..488799 (-) 804 WP_089086739.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS889_RS02440 - 488769..489239 (-) 471 WP_000965788.1 hypothetical protein -
  CS889_RS02445 - 489294..491354 (-) 2061 WP_001942503.1 type IA DNA topoisomerase -
  CS889_RS02455 - 491375..493618 (-) 2244 Protein_469 type IV secretory system conjugative DNA transfer family protein -
  CS889_RS02460 - 493615..493842 (-) 228 Protein_470 replication regulatory RepB family protein -
  CS889_RS02465 - 493812..494696 (-) 885 WP_089086741.1 ATPase, T2SS/T4P/T4SS family -
  CS889_RS02470 - 494701..494976 (-) 276 WP_089086742.1 hypothetical protein -
  CS889_RS02475 - 494993..495955 (-) 963 WP_089086743.1 hypothetical protein -
  CS889_RS02480 - 495968..498190 (-) 2223 WP_089086744.1 RGS domain-containing GTPase-activating protein -
  CS889_RS02485 comB10 498174..499379 (-) 1206 WP_089086745.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS889_RS02490 - 499376..501031 (-) 1656 WP_000617227.1 TrbG/VirB9 family P-type conjugative transfer protein -
  CS889_RS02495 - 501028..502164 (-) 1137 WP_089086746.1 VirB8/TrbF family protein -
  CS889_RS08420 - 502157..502297 (-) 141 WP_000789928.1 hypothetical protein -
  CS889_RS02505 - 502294..504844 (-) 2551 Protein_479 VirB4 family type IV secretion/conjugal transfer ATPase -
  CS889_RS02510 - 504844..505080 (-) 237 WP_001168537.1 hypothetical protein -
  CS889_RS02515 comB3 505092..505355 (-) 264 WP_001177718.1 hypothetical protein Machinery gene
  CS889_RS02520 comB2 505367..505651 (-) 285 WP_000413637.1 TrbC/VirB2 family protein Machinery gene
  CS889_RS02525 - 505639..506127 (-) 489 WP_089086747.1 hypothetical protein -
  CS889_RS02530 - 506191..506349 (-) 159 WP_231899360.1 hypothetical protein -
  CS889_RS02535 - 506352..507152 (-) 801 WP_089086748.1 integrase -
  CS889_RS02540 - 507207..507743 (+) 537 Protein_486 DNA adenine methylase -
  CS889_RS02545 - 507746..508369 (+) 624 WP_089086749.1 GIY-YIG nuclease family protein -
  CS889_RS02550 - 508517..508879 (+) 363 Protein_488 DNA cytosine methyltransferase -
  CS889_RS02555 - 509039..509983 (-) 945 WP_089086751.1 catalase family peroxidase -
  CS889_RS02560 hofC 510270..511856 (+) 1587 WP_089086752.1 outer membrane beta-barrel protein HofC -
  CS889_RS02565 hofD 511928..513325 (+) 1398 WP_089086753.1 outer membrane beta-barrel protein HofD -
  CS889_RS02580 - 513643..516102 (+) 2460 WP_414842625.1 DUF3519 domain-containing protein -
  CS889_RS02585 - 516112..516533 (+) 422 Protein_493 hypothetical protein -
  CS889_RS02590 - 516530..517077 (+) 548 Protein_494 hypothetical protein -
  CS889_RS02595 - 517317..518453 (-) 1137 WP_000461999.1 potassium channel family protein -
  CS889_RS02605 rpmB 518640..518828 (-) 189 WP_001118998.1 50S ribosomal protein L28 -
  CS889_RS02610 - 518921..519760 (-) 840 WP_089086759.1 HpaA family protein -
  CS889_RS02615 mraY 519891..520952 (+) 1062 WP_089087378.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  CS889_RS02620 murD 520954..522222 (+) 1269 WP_089086760.1 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase -
  CS889_RS02625 - 522219..522479 (-) 261 WP_089086761.1 DUF493 family protein -
  CS889_RS02630 - 522469..522777 (-) 309 WP_089086762.1 hotdog domain-containing protein -
  CS889_RS02635 - 523010..524338 (+) 1329 WP_000526620.1 sodium-dependent transporter -
  CS889_RS02640 - 524349..525677 (+) 1329 WP_089086763.1 sodium-dependent transporter -
  CS889_RS02645 - 525692..526758 (+) 1067 Protein_504 phospholipase A -
  CS889_RS02650 dnaN 526814..527938 (+) 1125 WP_089086764.1 DNA polymerase III subunit beta -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10753.05 Da        Isoelectric Point: 10.7837

>NTDB_id=1145871 CS889_RS02520 WP_000413637.1 505367..505651(-) (comB2) [Helicobacter pylori isolate HE147/09]
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF

Nucleotide


Download         Length: 285 bp        

>NTDB_id=1145871 CS889_RS02520 WP_000413637.1 505367..505651(-) (comB2) [Helicobacter pylori isolate HE147/09]
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA

Domains


Predicted by InterproScan.

(6-90)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB2 Helicobacter pylori 26695

57.778

95.745

0.553


Multiple sequence alignment