Detailed information
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | CS883_RS02515 | Genome accession | NZ_LT635476 |
| Coordinates | 505085..505348 (-) | Length | 87 a.a. |
| NCBI ID | WP_001177718.1 | Uniprot ID | A0AAV3IH30 |
| Organism | Helicobacter pylori isolate HE134/09 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 446989..528537 | 505085..505348 | within | 0 |
Gene organization within MGE regions
Location: 446989..528537
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS883_RS02265 | - | 447845..450124 (-) | 2280 | WP_231899392.1 | DEAD/DEAH box helicase family protein | - |
| CS883_RS08395 | - | 450298..450989 (-) | 692 | Protein_432 | type I restriction endonuclease | - |
| CS883_RS02270 | - | 451037..452932 (-) | 1896 | WP_089086720.1 | motility associated factor glycosyltransferase family protein | - |
| CS883_RS02275 | - | 452957..453724 (-) | 768 | WP_089086721.1 | TerB family tellurite resistance protein | - |
| CS883_RS02280 | - | 453734..454048 (-) | 315 | WP_001878784.1 | hypothetical protein | - |
| CS883_RS02285 | - | 454050..455537 (-) | 1488 | WP_089086722.1 | DUF5644 domain-containing protein | - |
| CS883_RS02290 | - | 455549..456037 (-) | 489 | WP_089086723.1 | hypothetical protein | - |
| CS883_RS02295 | - | 456022..457758 (-) | 1737 | WP_089086724.1 | M3 family oligoendopeptidase | - |
| CS883_RS02300 | - | 457855..459105 (-) | 1251 | WP_000431942.1 | cation:proton antiporter | - |
| CS883_RS08400 | - | 459259..459441 (-) | 183 | Protein_440 | hypothetical protein | - |
| CS883_RS02310 | - | 459425..459985 (-) | 561 | WP_000595776.1 | outer membrane beta-barrel protein | - |
| CS883_RS02315 | modA | 460211..460951 (+) | 741 | WP_089086725.1 | molybdate ABC transporter substrate-binding protein | - |
| CS883_RS02320 | modB | 460974..461648 (+) | 675 | WP_000349430.1 | molybdate ABC transporter permease subunit | - |
| CS883_RS02325 | - | 461645..462442 (+) | 798 | WP_089086726.1 | ATP-binding cassette domain-containing protein | - |
| CS883_RS02330 | gltX | 462560..463951 (-) | 1392 | WP_089086727.1 | glutamate--tRNA ligase | - |
| CS883_RS02335 | hopJ | 464069..465181 (+) | 1113 | WP_089086728.1 | Hop family outer membrane protein HopJ/HopK | - |
| CS883_RS02340 | - | 465190..466827 (+) | 1638 | Protein_447 | TaqI-like C-terminal specificity domain-containing protein | - |
| CS883_RS02345 | - | 466793..467641 (+) | 849 | WP_089086729.1 | glycosyltransferase family 9 protein | - |
| CS883_RS02350 | typA | 467687..469486 (+) | 1800 | WP_000790195.1 | translational GTPase TypA | - |
| CS883_RS02355 | - | 469502..469899 (+) | 398 | Protein_450 | DNA adenine methylase | - |
| CS883_RS02360 | - | 470657..472690 (+) | 2034 | WP_089086730.1 | relaxase/mobilization nuclease domain-containing protein | - |
| CS883_RS02365 | - | 473843..474910 (+) | 1068 | Protein_452 | tyrosine-type recombinase/integrase | - |
| CS883_RS02370 | - | 475227..476030 (-) | 804 | WP_089086732.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS883_RS02375 | - | 476002..476253 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| CS883_RS02380 | - | 476385..477065 (-) | 681 | WP_001153463.1 | hypothetical protein | - |
| CS883_RS02385 | - | 477286..478299 (+) | 1014 | WP_089086733.1 | hypothetical protein | - |
| CS883_RS02390 | - | 478304..479580 (-) | 1277 | Protein_457 | hypothetical protein | - |
| CS883_RS02395 | - | 479577..480839 (-) | 1263 | WP_089086734.1 | type IV secretion system protein | - |
| CS883_RS02400 | - | 480836..482269 (-) | 1434 | WP_089086735.1 | hypothetical protein | - |
| CS883_RS02405 | - | 482279..484325 (-) | 2047 | Protein_460 | hypothetical protein | - |
| CS883_RS02410 | - | 484325..485377 (-) | 1053 | WP_089086736.1 | ArdC family protein | - |
| CS883_RS08280 | - | 485378..485542 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| CS883_RS02420 | - | 486180..486848 (+) | 669 | WP_089086737.1 | ParA family protein | - |
| CS883_RS02425 | - | 486895..487272 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| CS883_RS02430 | - | 487250..487915 (+) | 666 | WP_089086738.1 | hypothetical protein | - |
| CS883_RS02435 | - | 487989..488792 (-) | 804 | WP_089086739.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS883_RS02440 | - | 488762..489232 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| CS883_RS02445 | - | 489287..491347 (-) | 2061 | WP_001942503.1 | type IA DNA topoisomerase | - |
| CS883_RS02455 | - | 491368..493611 (-) | 2244 | Protein_469 | type IV secretory system conjugative DNA transfer family protein | - |
| CS883_RS02460 | - | 493608..493835 (-) | 228 | Protein_470 | replication regulatory RepB family protein | - |
| CS883_RS02465 | - | 493805..494689 (-) | 885 | WP_089086741.1 | ATPase, T2SS/T4P/T4SS family | - |
| CS883_RS02470 | - | 494694..494969 (-) | 276 | WP_089086742.1 | hypothetical protein | - |
| CS883_RS02475 | - | 494986..495948 (-) | 963 | WP_089086743.1 | hypothetical protein | - |
| CS883_RS02480 | - | 495961..498183 (-) | 2223 | WP_089086744.1 | RGS domain-containing GTPase-activating protein | - |
| CS883_RS02485 | comB10 | 498167..499372 (-) | 1206 | WP_089086745.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| CS883_RS02490 | - | 499369..501024 (-) | 1656 | WP_000617227.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| CS883_RS02495 | - | 501021..502157 (-) | 1137 | WP_089086746.1 | VirB8/TrbF family protein | - |
| CS883_RS08405 | - | 502150..502290 (-) | 141 | WP_000789928.1 | hypothetical protein | - |
| CS883_RS02505 | - | 502287..504837 (-) | 2551 | Protein_479 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| CS883_RS02510 | - | 504837..505073 (-) | 237 | WP_001168537.1 | hypothetical protein | - |
| CS883_RS02515 | comB3 | 505085..505348 (-) | 264 | WP_001177718.1 | hypothetical protein | Machinery gene |
| CS883_RS02520 | comB2 | 505360..505644 (-) | 285 | WP_000413637.1 | TrbC/VirB2 family protein | Machinery gene |
| CS883_RS02525 | - | 505632..506120 (-) | 489 | WP_089086747.1 | hypothetical protein | - |
| CS883_RS02530 | - | 506184..506342 (-) | 159 | WP_231899360.1 | hypothetical protein | - |
| CS883_RS02535 | - | 506345..507145 (-) | 801 | WP_089086748.1 | integrase | - |
| CS883_RS02540 | - | 507200..507736 (+) | 537 | Protein_486 | DNA adenine methylase | - |
| CS883_RS02545 | - | 507739..508362 (+) | 624 | WP_089086749.1 | GIY-YIG nuclease family protein | - |
| CS883_RS02550 | - | 508510..508872 (+) | 363 | Protein_488 | DNA cytosine methyltransferase | - |
| CS883_RS02555 | - | 509032..509976 (-) | 945 | WP_089086751.1 | catalase family peroxidase | - |
| CS883_RS02560 | hofC | 510263..511849 (+) | 1587 | WP_089086752.1 | outer membrane beta-barrel protein HofC | - |
| CS883_RS02565 | hofD | 511921..513318 (+) | 1398 | WP_089086753.1 | outer membrane beta-barrel protein HofD | - |
| CS883_RS08285 | - | 513548..513748 (-) | 201 | WP_089086754.1 | hypothetical protein | - |
| CS883_RS02580 | - | 513717..516095 (+) | 2379 | WP_231899382.1 | DUF3519 domain-containing protein | - |
| CS883_RS02585 | - | 516105..516526 (+) | 422 | Protein_494 | hypothetical protein | - |
| CS883_RS02590 | - | 516523..517070 (+) | 548 | Protein_495 | hypothetical protein | - |
| CS883_RS02595 | - | 517310..518446 (-) | 1137 | WP_000461999.1 | potassium channel family protein | - |
| CS883_RS02605 | rpmB | 518633..518821 (-) | 189 | WP_001118998.1 | 50S ribosomal protein L28 | - |
| CS883_RS02610 | - | 518914..519753 (-) | 840 | WP_089086759.1 | HpaA family protein | - |
| CS883_RS02615 | mraY | 519884..520945 (+) | 1062 | WP_089087378.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| CS883_RS02620 | murD | 520947..522215 (+) | 1269 | WP_089086760.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| CS883_RS02625 | - | 522212..522472 (-) | 261 | WP_089086761.1 | DUF493 family protein | - |
| CS883_RS02630 | - | 522462..522770 (-) | 309 | WP_089086762.1 | hotdog domain-containing protein | - |
| CS883_RS02635 | - | 523003..524331 (+) | 1329 | WP_000526620.1 | sodium-dependent transporter | - |
| CS883_RS02640 | - | 524342..525670 (+) | 1329 | WP_089086763.1 | sodium-dependent transporter | - |
| CS883_RS02645 | - | 525685..526752 (+) | 1068 | WP_099167462.1 | phospholipase A | - |
| CS883_RS02650 | dnaN | 526808..527932 (+) | 1125 | WP_089086764.1 | DNA polymerase III subunit beta | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9988.86 Da Isoelectric Point: 5.7206
>NTDB_id=1145847 CS883_RS02515 WP_001177718.1 505085..505348(-) (comB3) [Helicobacter pylori isolate HE134/09]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=1145847 CS883_RS02515 WP_001177718.1 505085..505348(-) (comB3) [Helicobacter pylori isolate HE134/09]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
60.92 |
100 |
0.609 |