Detailed information
Bioinformatically predicted
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | CS896_RS02510 | Genome accession | NZ_LT635474 |
| Coordinates | 505087..505350 (-) | Length | 87 a.a. |
| NCBI ID | WP_001177718.1 | Uniprot ID | A0AAV3IH30 |
| Organism | Helicobacter pylori isolate HE171/09 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 446991..528538 | 505087..505350 | within | 0 |
Gene organization within MGE regions
Location: 446991..528538
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS896_RS02260 | - | 447847..450126 (-) | 2280 | WP_231899392.1 | DEAD/DEAH box helicase family protein | - |
| CS896_RS08400 | - | 450300..450991 (-) | 692 | Protein_433 | type I restriction endonuclease | - |
| CS896_RS02265 | - | 451039..452934 (-) | 1896 | WP_089086720.1 | motility associated factor glycosyltransferase family protein | - |
| CS896_RS02270 | - | 452959..453726 (-) | 768 | WP_089086721.1 | TerB family tellurite resistance protein | - |
| CS896_RS02275 | - | 453736..454050 (-) | 315 | WP_001878784.1 | hypothetical protein | - |
| CS896_RS02280 | - | 454052..455539 (-) | 1488 | WP_089086722.1 | DUF5644 domain-containing protein | - |
| CS896_RS02285 | - | 455551..456039 (-) | 489 | WP_089086723.1 | hypothetical protein | - |
| CS896_RS02290 | - | 456024..457760 (-) | 1737 | WP_089086724.1 | M3 family oligoendopeptidase | - |
| CS896_RS02295 | - | 457857..459107 (-) | 1251 | WP_000431942.1 | cation:proton antiporter | - |
| CS896_RS08405 | - | 459261..459443 (-) | 183 | Protein_441 | hypothetical protein | - |
| CS896_RS02305 | - | 459427..459987 (-) | 561 | WP_000595776.1 | outer membrane beta-barrel protein | - |
| CS896_RS02310 | modA | 460213..460953 (+) | 741 | WP_089086725.1 | molybdate ABC transporter substrate-binding protein | - |
| CS896_RS02315 | modB | 460976..461650 (+) | 675 | WP_000349430.1 | molybdate ABC transporter permease subunit | - |
| CS896_RS02320 | - | 461647..462444 (+) | 798 | WP_089086726.1 | ATP-binding cassette domain-containing protein | - |
| CS896_RS02325 | gltX | 462562..463953 (-) | 1392 | WP_089086727.1 | glutamate--tRNA ligase | - |
| CS896_RS02330 | hopJ | 464071..465183 (+) | 1113 | WP_089086728.1 | Hop family outer membrane protein HopJ/HopK | - |
| CS896_RS02335 | - | 465192..466829 (+) | 1638 | Protein_448 | TaqI-like C-terminal specificity domain-containing protein | - |
| CS896_RS02340 | - | 466795..467643 (+) | 849 | WP_089086729.1 | glycosyltransferase family 9 protein | - |
| CS896_RS02345 | typA | 467689..469488 (+) | 1800 | WP_000790195.1 | translational GTPase TypA | - |
| CS896_RS02350 | - | 469504..469901 (+) | 398 | Protein_451 | DNA adenine methylase | - |
| CS896_RS02355 | - | 470659..472692 (+) | 2034 | WP_089086730.1 | relaxase/mobilization nuclease domain-containing protein | - |
| CS896_RS02360 | - | 473845..474912 (+) | 1068 | Protein_453 | tyrosine-type recombinase/integrase | - |
| CS896_RS02365 | - | 475229..476032 (-) | 804 | WP_089086732.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS896_RS02370 | - | 476004..476255 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| CS896_RS02375 | - | 476387..477067 (-) | 681 | WP_001153463.1 | hypothetical protein | - |
| CS896_RS02380 | - | 477288..478301 (+) | 1014 | WP_089086733.1 | hypothetical protein | - |
| CS896_RS02385 | - | 478306..479582 (-) | 1277 | Protein_458 | hypothetical protein | - |
| CS896_RS02390 | - | 479579..480841 (-) | 1263 | WP_089086734.1 | type IV secretion system protein | - |
| CS896_RS02395 | - | 480838..482271 (-) | 1434 | WP_089086735.1 | hypothetical protein | - |
| CS896_RS02400 | - | 482281..484327 (-) | 2047 | Protein_461 | hypothetical protein | - |
| CS896_RS02405 | - | 484327..485379 (-) | 1053 | WP_089086736.1 | ArdC family protein | - |
| CS896_RS08285 | - | 485380..485544 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| CS896_RS02415 | - | 486182..486850 (+) | 669 | WP_089086737.1 | ParA family protein | - |
| CS896_RS02420 | - | 486897..487274 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| CS896_RS02425 | - | 487252..487917 (+) | 666 | WP_089086738.1 | hypothetical protein | - |
| CS896_RS02430 | - | 487991..488794 (-) | 804 | WP_089086739.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS896_RS02435 | - | 488764..489234 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| CS896_RS02440 | - | 489289..491349 (-) | 2061 | WP_001942503.1 | type IA DNA topoisomerase | - |
| CS896_RS02450 | - | 491370..493613 (-) | 2244 | Protein_470 | type IV secretory system conjugative DNA transfer family protein | - |
| CS896_RS02455 | - | 493610..493837 (-) | 228 | Protein_471 | replication regulatory RepB family protein | - |
| CS896_RS02460 | - | 493807..494691 (-) | 885 | WP_089086741.1 | ATPase, T2SS/T4P/T4SS family | - |
| CS896_RS02465 | - | 494696..494971 (-) | 276 | WP_089086742.1 | hypothetical protein | - |
| CS896_RS02470 | - | 494988..495950 (-) | 963 | WP_089086743.1 | hypothetical protein | - |
| CS896_RS02475 | - | 495963..498185 (-) | 2223 | WP_089086744.1 | RGS domain-containing GTPase-activating protein | - |
| CS896_RS02480 | comB10 | 498169..499374 (-) | 1206 | WP_089086745.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| CS896_RS02485 | - | 499371..501026 (-) | 1656 | WP_000617227.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| CS896_RS02490 | - | 501023..502159 (-) | 1137 | WP_089086746.1 | VirB8/TrbF family protein | - |
| CS896_RS08410 | - | 502152..502292 (-) | 141 | WP_000789928.1 | hypothetical protein | - |
| CS896_RS02500 | - | 502289..504839 (-) | 2551 | Protein_480 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| CS896_RS02505 | - | 504839..505075 (-) | 237 | WP_001168537.1 | hypothetical protein | - |
| CS896_RS02510 | comB3 | 505087..505350 (-) | 264 | WP_001177718.1 | hypothetical protein | Machinery gene |
| CS896_RS02515 | comB2 | 505362..505646 (-) | 285 | WP_000413637.1 | TrbC/VirB2 family protein | Machinery gene |
| CS896_RS02520 | - | 505634..506122 (-) | 489 | WP_089086747.1 | hypothetical protein | - |
| CS896_RS02525 | - | 506186..506344 (-) | 159 | WP_231899360.1 | hypothetical protein | - |
| CS896_RS02530 | - | 506347..507147 (-) | 801 | WP_089086748.1 | integrase | - |
| CS896_RS02535 | - | 507202..507738 (+) | 537 | Protein_487 | DNA adenine methylase | - |
| CS896_RS02540 | - | 507741..508364 (+) | 624 | WP_089086749.1 | GIY-YIG nuclease family protein | - |
| CS896_RS02545 | - | 508512..508874 (+) | 363 | Protein_489 | DNA cytosine methyltransferase | - |
| CS896_RS02550 | - | 509034..509978 (-) | 945 | WP_089086751.1 | catalase family peroxidase | - |
| CS896_RS02555 | hofC | 510265..511851 (+) | 1587 | WP_089086752.1 | outer membrane beta-barrel protein HofC | - |
| CS896_RS02560 | hofD | 511923..513320 (+) | 1398 | WP_089086753.1 | outer membrane beta-barrel protein HofD | - |
| CS896_RS08290 | - | 513550..513750 (-) | 201 | WP_089086754.1 | hypothetical protein | - |
| CS896_RS02575 | - | 513719..516097 (+) | 2379 | WP_231899382.1 | DUF3519 domain-containing protein | - |
| CS896_RS02580 | - | 516107..516528 (+) | 422 | Protein_495 | hypothetical protein | - |
| CS896_RS02585 | - | 516525..517072 (+) | 548 | Protein_496 | hypothetical protein | - |
| CS896_RS02590 | - | 517312..518448 (-) | 1137 | WP_000461999.1 | potassium channel family protein | - |
| CS896_RS02600 | rpmB | 518635..518823 (-) | 189 | WP_001118998.1 | 50S ribosomal protein L28 | - |
| CS896_RS02605 | - | 518916..519755 (-) | 840 | WP_089086759.1 | HpaA family protein | - |
| CS896_RS02610 | mraY | 519886..520947 (+) | 1062 | WP_089087378.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| CS896_RS02615 | murD | 520949..522217 (+) | 1269 | WP_089086760.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| CS896_RS02620 | - | 522214..522474 (-) | 261 | WP_089086761.1 | DUF493 family protein | - |
| CS896_RS02625 | - | 522464..522772 (-) | 309 | WP_089086762.1 | hotdog domain-containing protein | - |
| CS896_RS02630 | - | 523005..524333 (+) | 1329 | WP_000526620.1 | sodium-dependent transporter | - |
| CS896_RS02635 | - | 524344..525672 (+) | 1329 | WP_089086763.1 | sodium-dependent transporter | - |
| CS896_RS02640 | - | 525687..526753 (+) | 1067 | Protein_506 | phospholipase A | - |
| CS896_RS02645 | dnaN | 526809..527933 (+) | 1125 | WP_089086764.1 | DNA polymerase III subunit beta | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9988.86 Da Isoelectric Point: 5.7206
>NTDB_id=1145815 CS896_RS02510 WP_001177718.1 505087..505350(-) (comB3) [Helicobacter pylori isolate HE171/09]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=1145815 CS896_RS02510 WP_001177718.1 505087..505350(-) (comB3) [Helicobacter pylori isolate HE171/09]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
60.92 |
100 |
0.609 |