Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | CS890_RS02515 | Genome accession | NZ_LT635471 |
| Coordinates | 505359..505643 (-) | Length | 94 a.a. |
| NCBI ID | WP_000413637.1 | Uniprot ID | A0AB72ZV75 |
| Organism | Helicobacter pylori isolate HE141/09 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 446988..528536 | 505359..505643 | within | 0 |
Gene organization within MGE regions
Location: 446988..528536
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS890_RS02260 | - | 447844..450123 (-) | 2280 | WP_231899392.1 | DEAD/DEAH box helicase family protein | - |
| CS890_RS08400 | - | 450297..450988 (-) | 692 | Protein_432 | type I restriction endonuclease | - |
| CS890_RS02265 | - | 451036..452931 (-) | 1896 | WP_089086720.1 | motility associated factor glycosyltransferase family protein | - |
| CS890_RS02270 | - | 452956..453723 (-) | 768 | WP_089086721.1 | TerB family tellurite resistance protein | - |
| CS890_RS02275 | - | 453733..454047 (-) | 315 | WP_001878784.1 | hypothetical protein | - |
| CS890_RS02280 | - | 454049..455536 (-) | 1488 | WP_089086722.1 | DUF5644 domain-containing protein | - |
| CS890_RS02285 | - | 455548..456036 (-) | 489 | WP_089086723.1 | hypothetical protein | - |
| CS890_RS02290 | - | 456021..457757 (-) | 1737 | WP_089086724.1 | M3 family oligoendopeptidase | - |
| CS890_RS02295 | - | 457854..459104 (-) | 1251 | WP_000431942.1 | cation:proton antiporter | - |
| CS890_RS08405 | - | 459258..459440 (-) | 183 | Protein_440 | hypothetical protein | - |
| CS890_RS02305 | - | 459424..459984 (-) | 561 | WP_000595776.1 | outer membrane beta-barrel protein | - |
| CS890_RS02310 | modA | 460210..460950 (+) | 741 | WP_089086725.1 | molybdate ABC transporter substrate-binding protein | - |
| CS890_RS02315 | modB | 460973..461647 (+) | 675 | WP_000349430.1 | molybdate ABC transporter permease subunit | - |
| CS890_RS02320 | - | 461644..462441 (+) | 798 | WP_089086726.1 | ATP-binding cassette domain-containing protein | - |
| CS890_RS02325 | gltX | 462559..463950 (-) | 1392 | WP_089086727.1 | glutamate--tRNA ligase | - |
| CS890_RS02330 | hopJ | 464068..465180 (+) | 1113 | WP_089086728.1 | Hop family outer membrane protein HopJ/HopK | - |
| CS890_RS02335 | - | 465189..466826 (+) | 1638 | Protein_447 | TaqI-like C-terminal specificity domain-containing protein | - |
| CS890_RS02340 | - | 466792..467640 (+) | 849 | WP_089086729.1 | glycosyltransferase family 9 protein | - |
| CS890_RS02345 | typA | 467686..469485 (+) | 1800 | WP_000790195.1 | translational GTPase TypA | - |
| CS890_RS02350 | - | 469501..469898 (+) | 398 | Protein_450 | DNA adenine methylase | - |
| CS890_RS02355 | - | 470656..472689 (+) | 2034 | WP_089086730.1 | relaxase/mobilization nuclease domain-containing protein | - |
| CS890_RS02360 | - | 473842..474909 (+) | 1068 | Protein_452 | tyrosine-type recombinase/integrase | - |
| CS890_RS02365 | - | 475226..476029 (-) | 804 | WP_089086732.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS890_RS02370 | - | 476001..476252 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| CS890_RS02375 | - | 476384..477064 (-) | 681 | WP_001153463.1 | hypothetical protein | - |
| CS890_RS02380 | - | 477285..478298 (+) | 1014 | WP_089086733.1 | hypothetical protein | - |
| CS890_RS02385 | - | 478303..479579 (-) | 1277 | Protein_457 | hypothetical protein | - |
| CS890_RS02390 | - | 479576..480838 (-) | 1263 | WP_089086734.1 | type IV secretion system protein | - |
| CS890_RS02395 | - | 480835..482268 (-) | 1434 | WP_089086735.1 | hypothetical protein | - |
| CS890_RS02400 | - | 482278..484324 (-) | 2047 | Protein_460 | hypothetical protein | - |
| CS890_RS02405 | - | 484324..485376 (-) | 1053 | WP_089086736.1 | ArdC family protein | - |
| CS890_RS08295 | - | 485377..485541 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| CS890_RS02415 | - | 486179..486847 (+) | 669 | WP_089086737.1 | ParA family protein | - |
| CS890_RS02420 | - | 486894..487271 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| CS890_RS02425 | - | 487249..487914 (+) | 666 | WP_089086738.1 | hypothetical protein | - |
| CS890_RS02430 | - | 487988..488791 (-) | 804 | WP_089086739.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS890_RS02435 | - | 488761..489231 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| CS890_RS02440 | - | 489286..491346 (-) | 2061 | WP_001942503.1 | type IA DNA topoisomerase | - |
| CS890_RS02450 | - | 491367..493610 (-) | 2244 | Protein_469 | type IV secretory system conjugative DNA transfer family protein | - |
| CS890_RS02455 | - | 493607..493834 (-) | 228 | Protein_470 | replication regulatory RepB family protein | - |
| CS890_RS02460 | - | 493804..494688 (-) | 885 | WP_089086741.1 | ATPase, T2SS/T4P/T4SS family | - |
| CS890_RS02465 | - | 494693..494968 (-) | 276 | WP_089086742.1 | hypothetical protein | - |
| CS890_RS02470 | - | 494985..495947 (-) | 963 | WP_089086743.1 | hypothetical protein | - |
| CS890_RS02475 | - | 495960..498182 (-) | 2223 | WP_089086744.1 | RGS domain-containing GTPase-activating protein | - |
| CS890_RS02480 | comB10 | 498166..499371 (-) | 1206 | WP_089086745.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| CS890_RS02485 | - | 499368..501023 (-) | 1656 | WP_000617227.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| CS890_RS02490 | - | 501020..502156 (-) | 1137 | WP_089086746.1 | VirB8/TrbF family protein | - |
| CS890_RS08410 | - | 502149..502289 (-) | 141 | WP_000789928.1 | hypothetical protein | - |
| CS890_RS02500 | - | 502286..504836 (-) | 2551 | Protein_479 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| CS890_RS02505 | - | 504836..505072 (-) | 237 | WP_001168537.1 | hypothetical protein | - |
| CS890_RS02510 | comB3 | 505084..505347 (-) | 264 | WP_001177718.1 | hypothetical protein | Machinery gene |
| CS890_RS02515 | comB2 | 505359..505643 (-) | 285 | WP_000413637.1 | TrbC/VirB2 family protein | Machinery gene |
| CS890_RS02520 | - | 505631..506119 (-) | 489 | WP_089086747.1 | hypothetical protein | - |
| CS890_RS02525 | - | 506183..506341 (-) | 159 | WP_231899360.1 | hypothetical protein | - |
| CS890_RS02530 | - | 506344..507144 (-) | 801 | WP_089086748.1 | integrase | - |
| CS890_RS02535 | - | 507199..507735 (+) | 537 | Protein_486 | DNA adenine methylase | - |
| CS890_RS02540 | - | 507738..508361 (+) | 624 | WP_089086749.1 | GIY-YIG nuclease family protein | - |
| CS890_RS02545 | - | 508509..508871 (+) | 363 | Protein_488 | DNA cytosine methyltransferase | - |
| CS890_RS02550 | - | 509031..509975 (-) | 945 | WP_089086751.1 | catalase family peroxidase | - |
| CS890_RS02555 | hofC | 510262..511848 (+) | 1587 | WP_089086752.1 | outer membrane beta-barrel protein HofC | - |
| CS890_RS02560 | hofD | 511920..513317 (+) | 1398 | WP_089086753.1 | outer membrane beta-barrel protein HofD | - |
| CS890_RS08300 | - | 513547..513747 (-) | 201 | WP_089086754.1 | hypothetical protein | - |
| CS890_RS02575 | - | 513716..516094 (+) | 2379 | WP_231899382.1 | DUF3519 domain-containing protein | - |
| CS890_RS02580 | - | 516104..516525 (+) | 422 | Protein_494 | hypothetical protein | - |
| CS890_RS02585 | - | 516522..517069 (+) | 548 | Protein_495 | hypothetical protein | - |
| CS890_RS02590 | - | 517309..518445 (-) | 1137 | WP_000461999.1 | potassium channel family protein | - |
| CS890_RS02600 | rpmB | 518632..518820 (-) | 189 | WP_001118998.1 | 50S ribosomal protein L28 | - |
| CS890_RS02605 | - | 518913..519752 (-) | 840 | WP_089086759.1 | HpaA family protein | - |
| CS890_RS02610 | mraY | 519883..520944 (+) | 1062 | WP_089087378.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| CS890_RS02615 | murD | 520946..522214 (+) | 1269 | WP_089086760.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| CS890_RS02620 | - | 522211..522471 (-) | 261 | WP_089086761.1 | DUF493 family protein | - |
| CS890_RS02625 | - | 522461..522769 (-) | 309 | WP_089086762.1 | hotdog domain-containing protein | - |
| CS890_RS02630 | - | 523002..524330 (+) | 1329 | WP_000526620.1 | sodium-dependent transporter | - |
| CS890_RS02635 | - | 524341..525669 (+) | 1329 | WP_089086763.1 | sodium-dependent transporter | - |
| CS890_RS02640 | - | 525684..526751 (+) | 1068 | WP_099167462.1 | phospholipase A | - |
| CS890_RS02645 | dnaN | 526807..527931 (+) | 1125 | WP_089086764.1 | DNA polymerase III subunit beta | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10753.05 Da Isoelectric Point: 10.7837
>NTDB_id=1145747 CS890_RS02515 WP_000413637.1 505359..505643(-) (comB2) [Helicobacter pylori isolate HE141/09]
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=1145747 CS890_RS02515 WP_000413637.1 505359..505643(-) (comB2) [Helicobacter pylori isolate HE141/09]
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.778 |
95.745 |
0.553 |