Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB2   Type   Machinery gene
Locus tag   CS890_RS02515 Genome accession   NZ_LT635471
Coordinates   505359..505643 (-) Length   94 a.a.
NCBI ID   WP_000413637.1    Uniprot ID   A0AB72ZV75
Organism   Helicobacter pylori isolate HE141/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 446988..528536 505359..505643 within 0


Gene organization within MGE regions


Location: 446988..528536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS890_RS02260 - 447844..450123 (-) 2280 WP_231899392.1 DEAD/DEAH box helicase family protein -
  CS890_RS08400 - 450297..450988 (-) 692 Protein_432 type I restriction endonuclease -
  CS890_RS02265 - 451036..452931 (-) 1896 WP_089086720.1 motility associated factor glycosyltransferase family protein -
  CS890_RS02270 - 452956..453723 (-) 768 WP_089086721.1 TerB family tellurite resistance protein -
  CS890_RS02275 - 453733..454047 (-) 315 WP_001878784.1 hypothetical protein -
  CS890_RS02280 - 454049..455536 (-) 1488 WP_089086722.1 DUF5644 domain-containing protein -
  CS890_RS02285 - 455548..456036 (-) 489 WP_089086723.1 hypothetical protein -
  CS890_RS02290 - 456021..457757 (-) 1737 WP_089086724.1 M3 family oligoendopeptidase -
  CS890_RS02295 - 457854..459104 (-) 1251 WP_000431942.1 cation:proton antiporter -
  CS890_RS08405 - 459258..459440 (-) 183 Protein_440 hypothetical protein -
  CS890_RS02305 - 459424..459984 (-) 561 WP_000595776.1 outer membrane beta-barrel protein -
  CS890_RS02310 modA 460210..460950 (+) 741 WP_089086725.1 molybdate ABC transporter substrate-binding protein -
  CS890_RS02315 modB 460973..461647 (+) 675 WP_000349430.1 molybdate ABC transporter permease subunit -
  CS890_RS02320 - 461644..462441 (+) 798 WP_089086726.1 ATP-binding cassette domain-containing protein -
  CS890_RS02325 gltX 462559..463950 (-) 1392 WP_089086727.1 glutamate--tRNA ligase -
  CS890_RS02330 hopJ 464068..465180 (+) 1113 WP_089086728.1 Hop family outer membrane protein HopJ/HopK -
  CS890_RS02335 - 465189..466826 (+) 1638 Protein_447 TaqI-like C-terminal specificity domain-containing protein -
  CS890_RS02340 - 466792..467640 (+) 849 WP_089086729.1 glycosyltransferase family 9 protein -
  CS890_RS02345 typA 467686..469485 (+) 1800 WP_000790195.1 translational GTPase TypA -
  CS890_RS02350 - 469501..469898 (+) 398 Protein_450 DNA adenine methylase -
  CS890_RS02355 - 470656..472689 (+) 2034 WP_089086730.1 relaxase/mobilization nuclease domain-containing protein -
  CS890_RS02360 - 473842..474909 (+) 1068 Protein_452 tyrosine-type recombinase/integrase -
  CS890_RS02365 - 475226..476029 (-) 804 WP_089086732.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS890_RS02370 - 476001..476252 (-) 252 WP_000006537.1 hypothetical protein -
  CS890_RS02375 - 476384..477064 (-) 681 WP_001153463.1 hypothetical protein -
  CS890_RS02380 - 477285..478298 (+) 1014 WP_089086733.1 hypothetical protein -
  CS890_RS02385 - 478303..479579 (-) 1277 Protein_457 hypothetical protein -
  CS890_RS02390 - 479576..480838 (-) 1263 WP_089086734.1 type IV secretion system protein -
  CS890_RS02395 - 480835..482268 (-) 1434 WP_089086735.1 hypothetical protein -
  CS890_RS02400 - 482278..484324 (-) 2047 Protein_460 hypothetical protein -
  CS890_RS02405 - 484324..485376 (-) 1053 WP_089086736.1 ArdC family protein -
  CS890_RS08295 - 485377..485541 (-) 165 WP_000189763.1 hypothetical protein -
  CS890_RS02415 - 486179..486847 (+) 669 WP_089086737.1 ParA family protein -
  CS890_RS02420 - 486894..487271 (+) 378 WP_000365707.1 hypothetical protein -
  CS890_RS02425 - 487249..487914 (+) 666 WP_089086738.1 hypothetical protein -
  CS890_RS02430 - 487988..488791 (-) 804 WP_089086739.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  CS890_RS02435 - 488761..489231 (-) 471 WP_000965788.1 hypothetical protein -
  CS890_RS02440 - 489286..491346 (-) 2061 WP_001942503.1 type IA DNA topoisomerase -
  CS890_RS02450 - 491367..493610 (-) 2244 Protein_469 type IV secretory system conjugative DNA transfer family protein -
  CS890_RS02455 - 493607..493834 (-) 228 Protein_470 replication regulatory RepB family protein -
  CS890_RS02460 - 493804..494688 (-) 885 WP_089086741.1 ATPase, T2SS/T4P/T4SS family -
  CS890_RS02465 - 494693..494968 (-) 276 WP_089086742.1 hypothetical protein -
  CS890_RS02470 - 494985..495947 (-) 963 WP_089086743.1 hypothetical protein -
  CS890_RS02475 - 495960..498182 (-) 2223 WP_089086744.1 RGS domain-containing GTPase-activating protein -
  CS890_RS02480 comB10 498166..499371 (-) 1206 WP_089086745.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS890_RS02485 - 499368..501023 (-) 1656 WP_000617227.1 TrbG/VirB9 family P-type conjugative transfer protein -
  CS890_RS02490 - 501020..502156 (-) 1137 WP_089086746.1 VirB8/TrbF family protein -
  CS890_RS08410 - 502149..502289 (-) 141 WP_000789928.1 hypothetical protein -
  CS890_RS02500 - 502286..504836 (-) 2551 Protein_479 VirB4 family type IV secretion/conjugal transfer ATPase -
  CS890_RS02505 - 504836..505072 (-) 237 WP_001168537.1 hypothetical protein -
  CS890_RS02510 comB3 505084..505347 (-) 264 WP_001177718.1 hypothetical protein Machinery gene
  CS890_RS02515 comB2 505359..505643 (-) 285 WP_000413637.1 TrbC/VirB2 family protein Machinery gene
  CS890_RS02520 - 505631..506119 (-) 489 WP_089086747.1 hypothetical protein -
  CS890_RS02525 - 506183..506341 (-) 159 WP_231899360.1 hypothetical protein -
  CS890_RS02530 - 506344..507144 (-) 801 WP_089086748.1 integrase -
  CS890_RS02535 - 507199..507735 (+) 537 Protein_486 DNA adenine methylase -
  CS890_RS02540 - 507738..508361 (+) 624 WP_089086749.1 GIY-YIG nuclease family protein -
  CS890_RS02545 - 508509..508871 (+) 363 Protein_488 DNA cytosine methyltransferase -
  CS890_RS02550 - 509031..509975 (-) 945 WP_089086751.1 catalase family peroxidase -
  CS890_RS02555 hofC 510262..511848 (+) 1587 WP_089086752.1 outer membrane beta-barrel protein HofC -
  CS890_RS02560 hofD 511920..513317 (+) 1398 WP_089086753.1 outer membrane beta-barrel protein HofD -
  CS890_RS08300 - 513547..513747 (-) 201 WP_089086754.1 hypothetical protein -
  CS890_RS02575 - 513716..516094 (+) 2379 WP_231899382.1 DUF3519 domain-containing protein -
  CS890_RS02580 - 516104..516525 (+) 422 Protein_494 hypothetical protein -
  CS890_RS02585 - 516522..517069 (+) 548 Protein_495 hypothetical protein -
  CS890_RS02590 - 517309..518445 (-) 1137 WP_000461999.1 potassium channel family protein -
  CS890_RS02600 rpmB 518632..518820 (-) 189 WP_001118998.1 50S ribosomal protein L28 -
  CS890_RS02605 - 518913..519752 (-) 840 WP_089086759.1 HpaA family protein -
  CS890_RS02610 mraY 519883..520944 (+) 1062 WP_089087378.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  CS890_RS02615 murD 520946..522214 (+) 1269 WP_089086760.1 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase -
  CS890_RS02620 - 522211..522471 (-) 261 WP_089086761.1 DUF493 family protein -
  CS890_RS02625 - 522461..522769 (-) 309 WP_089086762.1 hotdog domain-containing protein -
  CS890_RS02630 - 523002..524330 (+) 1329 WP_000526620.1 sodium-dependent transporter -
  CS890_RS02635 - 524341..525669 (+) 1329 WP_089086763.1 sodium-dependent transporter -
  CS890_RS02640 - 525684..526751 (+) 1068 WP_099167462.1 phospholipase A -
  CS890_RS02645 dnaN 526807..527931 (+) 1125 WP_089086764.1 DNA polymerase III subunit beta -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10753.05 Da        Isoelectric Point: 10.7837

>NTDB_id=1145747 CS890_RS02515 WP_000413637.1 505359..505643(-) (comB2) [Helicobacter pylori isolate HE141/09]
MEKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF

Nucleotide


Download         Length: 285 bp        

>NTDB_id=1145747 CS890_RS02515 WP_000413637.1 505359..505643(-) (comB2) [Helicobacter pylori isolate HE141/09]
ATGGAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCTCTTTTATTACAAGCGGATATGACTAC
CTTTTTTAATTCCATTGAACAACAGCTCACTAGCCCTACGGCTAAAGGCATTTTAATGGTTATTTTTTTAGGACTTGCTA
TTTTTATATGGAAAAACTTAGATAGATGGAAAGAAATTTTAATGACCGTGCTTGCTATTGCAATTGGTGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAACTGGTTTATGAGTATTTTTTAA

Domains


Predicted by InterproScan.

(6-90)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB2 Helicobacter pylori 26695

57.778

95.745

0.553


Multiple sequence alignment