Detailed information
Bioinformatically predicted
Overview
| Name | pilD | Type | Machinery gene |
| Locus tag | DXE35_RS10050 | Genome accession | NZ_LT606949 |
| Coordinates | 316541..316648 (-) | Length | 35 a.a. |
| NCBI ID | WP_162784934.1 | Uniprot ID | - |
| Organism | Polynucleobacter necessarius isolate PPGSP7 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 311541..321648
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE35_RS10040 | - | 311716..311928 (-) | 213 | WP_231969923.1 | response regulator transcription factor | - |
| DXE35_RS10045 | - | 311900..312715 (-) | 816 | WP_162784933.1 | PAS domain-containing protein | - |
| DXE35_RS01790 | - | 312791..313144 (-) | 354 | Protein_367 | ATP-binding protein | - |
| DXE35_RS01795 | - | 313185..313742 (-) | 558 | WP_114689356.1 | SOS response-associated peptidase | - |
| DXE35_RS01800 | - | 314050..314589 (+) | 540 | WP_231969924.1 | peptidylprolyl isomerase | - |
| DXE35_RS01805 | - | 314774..315262 (-) | 489 | WP_231970131.1 | dihydrofolate reductase | - |
| DXE35_RS01810 | - | 315274..316068 (-) | 795 | WP_114689358.1 | thymidylate synthase | - |
| DXE35_RS01815 | - | 316078..316536 (-) | 459 | WP_114689359.1 | prepilin peptidase | - |
| DXE35_RS10050 | pilD | 316541..316648 (-) | 108 | WP_162784934.1 | prepilin peptidase | Machinery gene |
| DXE35_RS01820 | - | 316857..317438 (+) | 582 | WP_114689360.1 | transporter | - |
| DXE35_RS10055 | - | 317495..317893 (-) | 399 | WP_331851921.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
| DXE35_RS01830 | - | 318113..318346 (-) | 234 | WP_114689361.1 | lytic transglycosylase domain-containing protein | - |
| DXE35_RS01835 | - | 318384..318584 (+) | 201 | WP_114689362.1 | hypothetical protein | - |
| DXE35_RS01840 | - | 318700..318993 (-) | 294 | WP_162784935.1 | type II secretion system F family protein | - |
| DXE35_RS09195 | - | 318965..319210 (-) | 246 | WP_162784936.1 | hypothetical protein | - |
| DXE35_RS01845 | - | 319249..319947 (-) | 699 | WP_114689364.1 | type II secretion system F family protein | - |
| DXE35_RS01850 | - | 319977..321113 (-) | 1137 | WP_162784937.1 | ATPase, T2SS/T4P/T4SS family | - |
Sequence
Protein
Download Length: 35 a.a. Molecular weight: 3848.77 Da Isoelectric Point: 8.0302
>NTDB_id=1145208 DXE35_RS10050 WP_162784934.1 316541..316648(-) (pilD) [Polynucleobacter necessarius isolate PPGSP7]
MEIFVATIWGLIIGSLLNVVIHRLPKAVMKDPCVA
MEIFVATIWGLIIGSLLNVVIHRLPKAVMKDPCVA
Nucleotide
Download Length: 108 bp
>NTDB_id=1145208 DXE35_RS10050 WP_162784934.1 316541..316648(-) (pilD) [Polynucleobacter necessarius isolate PPGSP7]
ATGGAAATATTTGTCGCAACTATCTGGGGTCTCATCATCGGCAGTTTGCTGAATGTGGTGATTCATCGTCTGCCAAAAGC
GGTGATGAAAGATCCATGCGTCGCTTAA
ATGGAAATATTTGTCGCAACTATCTGGGGTCTCATCATCGGCAGTTTGCTGAATGTGGTGATTCATCGTCTGCCAAAAGC
GGTGATGAAAGATCCATGCGTCGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilD | Vibrio campbellii strain DS40M4 |
70.833 |
68.571 |
0.486 |
| pilD | Vibrio cholerae strain A1552 |
59.259 |
77.143 |
0.457 |
| pilD | Acinetobacter baumannii D1279779 |
61.905 |
60 |
0.371 |