Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   H0508_RS06465 Genome accession   NZ_LR822014
Coordinates   1257129..1258058 (-) Length   309 a.a.
NCBI ID   WP_002951426.1    Uniprot ID   A0A7U7CIU5
Organism   Streptococcus thermophilus isolate STH_CIRM_36     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1241595..1311683 1257129..1258058 within 0


Gene organization within MGE regions


Location: 1241595..1311683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0508_RS06390 (STHERMO_1422) liaF 1241603..1242301 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  H0508_RS09635 (STHERMO_1423) - 1242567..1242722 (-) 156 WP_011226290.1 ion channel -
  H0508_RS06400 (STHERMO_1426) stkP/pknB 1243359..1245230 (-) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  H0508_RS06405 (STHERMO_1427) - 1245230..1245967 (-) 738 WP_179971637.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  H0508_RS06410 (STHERMO_1428) rsmB 1246011..1247333 (-) 1323 WP_179971638.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  H0508_RS06415 (STHERMO_1429) fmt 1247323..1248258 (-) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  H0508_RS06420 (STHERMO_1430) - 1248276..1250672 (-) 2397 WP_011226295.1 primosomal protein N' -
  H0508_RS06425 (STHERMO_1431) rpoZ 1250814..1251128 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  H0508_RS06430 (STHERMO_1432) gmk 1251150..1251779 (-) 630 WP_011226296.1 guanylate kinase -
  H0508_RS06435 (STHERMO_1433) ftsY 1252012..1253403 (-) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  H0508_RS06440 (STHERMO_1434) - 1253417..1254232 (-) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  H0508_RS06445 (STHERMO_1435) - 1254225..1255019 (-) 795 WP_059257398.1 HAD hydrolase family protein -
  H0508_RS06450 (STHERMO_1436) - 1255202..1255579 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  H0508_RS06455 (STHERMO_1437) - 1255584..1256282 (+) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  H0508_RS06460 (STHERMO_1438) - 1256294..1257079 (+) 786 WP_002951425.1 hypothetical protein -
  H0508_RS06465 (STHERMO_1439) amiF 1257129..1258058 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  H0508_RS06470 (STHERMO_1440) amiE 1258051..1259136 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  H0508_RS06475 (STHERMO_1441) amiD 1259146..1260072 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  H0508_RS06480 (STHERMO_1442) amiC 1260072..1261565 (-) 1494 WP_011227407.1 ABC transporter permease Regulator
  H0508_RS06485 (STHERMO_1443) amiA 1261627..1263594 (-) 1968 WP_011225333.1 peptide ABC transporter substrate-binding protein Regulator
  H0508_RS09305 (STHERMO_1444) - 1263950..1265199 (+) 1250 Protein_1233 ISL3 family transposase -
  H0508_RS06495 (STHERMO_1445) amiA3 1265244..1267217 (-) 1974 WP_011226306.1 peptide ABC transporter substrate-binding protein Regulator
  H0508_RS06500 - 1267421..1267611 (-) 191 Protein_1235 IS3 family transposase -
  H0508_RS06505 (STHERMO_1446) - 1267605..1268015 (-) 411 Protein_1236 ATP-binding cassette domain-containing protein -
  H0508_RS06510 - 1268047..1268361 (-) 315 Protein_1237 TatD family hydrolase -
  H0508_RS06515 (STHERMO_1448) - 1268711..1269916 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  H0508_RS06520 - 1269962..1271313 (-) 1352 Protein_1239 IS3 family transposase -
  H0508_RS06525 (STHERMO_1453) pta 1271399..1272382 (-) 984 WP_011226315.1 phosphate acetyltransferase -
  H0508_RS06530 (STHERMO_1454) - 1272396..1273292 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  H0508_RS06535 (STHERMO_1455) - 1273289..1274125 (-) 837 WP_041827075.1 NAD kinase -
  H0508_RS06540 (STHERMO_1456) - 1274097..1274771 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  H0508_RS06545 (STHERMO_1457) - 1274867..1275442 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  H0508_RS06550 (STHERMO_1458) - 1275807..1276778 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  H0508_RS06555 (STHERMO_1459) - 1276782..1277894 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  H0508_RS06560 (STHERMO_1460) - 1277896..1278243 (+) 348 WP_011226321.1 DUF1831 domain-containing protein -
  H0508_RS06565 (STHERMO_1461) - 1278388..1279047 (+) 660 WP_041828288.1 redox-sensing transcriptional repressor Rex -
  H0508_RS06570 (STHERMO_1462) - 1279040..1279735 (+) 696 WP_011226323.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  H0508_RS06575 (STHERMO_1463) radC 1279788..1280474 (-) 687 WP_011226324.1 RadC family protein -
  H0508_RS06580 (STHERMO_1464) - 1280523..1282307 (-) 1785 WP_011226325.1 rhamnan synthesis F family protein -
  H0508_RS06585 (STHERMO_1465) - 1282304..1283359 (-) 1056 WP_002948022.1 glycosyltransferase family 2 protein -
  H0508_RS06590 (STHERMO_1466) - 1283379..1284584 (-) 1206 WP_011226326.1 ABC transporter ATP-binding protein -
  H0508_RS06595 (STHERMO_1467) - 1284584..1285393 (-) 810 WP_002948020.1 ABC transporter permease -
  H0508_RS06600 (STHERMO_1468) - 1285377..1286333 (-) 957 WP_011226328.1 glycosyltransferase family 2 protein -
  H0508_RS06605 (STHERMO_1469) cps2T 1286330..1287478 (-) 1149 WP_041828290.1 beta 1-4 rhamnosyltransferase Cps2T -
  H0508_RS06610 (STHERMO_1470) - 1287587..1288597 (-) 1011 WP_011226330.1 glycosyltransferase family 2 protein -
  H0508_RS06615 (STHERMO_1471) - 1288597..1289871 (-) 1275 WP_011226331.1 lipopolysaccharide biosynthesis protein -
  H0508_RS06620 (STHERMO_1472) - 1289864..1290196 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  H0508_RS06625 (STHERMO_1473) - 1290202..1290897 (-) 696 WP_173940715.1 glycosyltransferase family 2 protein -
  H0508_RS06630 (STHERMO_1474) rfbD 1290974..1291825 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  H0508_RS06635 (STHERMO_1475) - 1291902..1293236 (-) 1335 WP_041828293.1 DUF6056 family protein -
  H0508_RS06640 (STHERMO_1477) - 1293349..1294266 (-) 918 WP_002946425.1 glycosyltransferase family 2 protein -
  H0508_RS06645 (STHERMO_1478) - 1294329..1295744 (-) 1416 WP_096811580.1 DUF2142 domain-containing protein -
  H0508_RS06650 (STHERMO_1480) - 1296078..1296413 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  H0508_RS06655 (STHERMO_1481) rpoD 1296467..1297576 (-) 1110 WP_011226338.1 RNA polymerase sigma factor RpoD -
  H0508_RS06660 (STHERMO_1482) dnaG 1297580..1299391 (-) 1812 WP_011226339.1 DNA primase -
  H0508_RS06665 (STHERMO_1483) rpsU 1299762..1299938 (-) 177 WP_011226340.1 30S ribosomal protein S21 -
  H0508_RS06670 (STHERMO_1484) - 1300133..1300927 (-) 795 WP_011226341.1 transporter substrate-binding domain-containing protein -
  H0508_RS06675 (STHERMO_1485) - 1301020..1302129 (-) 1110 WP_179971671.1 aminotransferase -
  H0508_RS06680 (STHERMO_1486) - 1302476..1303273 (-) 798 WP_011226343.1 transporter substrate-binding domain-containing protein -
  H0508_RS06685 (STHERMO_1487) - 1303270..1304100 (-) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  H0508_RS06690 (STHERMO_1488) - 1304313..1304777 (-) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  H0508_RS06695 (STHERMO_1489) uvrB 1304822..1306813 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  H0508_RS09640 - 1306925..1307176 (+) 252 WP_179971767.1 hypothetical protein -
  H0508_RS09945 - 1307500..1308436 (-) 937 Protein_1276 CPBP family intramembrane glutamic endopeptidase -
  H0508_RS06705 (STHERMO_1494) - 1308635..1310845 (+) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  H0508_RS06710 (STHERMO_1495) - 1310845..1311585 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 309 a.a.        Molecular weight: 35171.28 Da        Isoelectric Point: 6.5989

>NTDB_id=1130857 H0508_RS06465 WP_002951426.1 1257129..1258058(-) (amiF) [Streptococcus thermophilus isolate STH_CIRM_36]
MPEKLVEVKDVEISFGEGRKKFVAVHNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGEIIFDGKKINGYLSHS
EKNDLIRRIQMIFQDPAASLNERATVDYILSEGLYNFHLYKDEEERKAKIKEIIKEVGLLEEHLTRYPHEFSGGQRQRIG
IARSLVMQPDLVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGTIVEVAETEELYN
NPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMVEVRPGHFVWGNKTEIETYRKEQSK

Nucleotide


Download         Length: 930 bp        

>NTDB_id=1130857 H0508_RS06465 WP_002951426.1 1257129..1258058(-) (amiF) [Streptococcus thermophilus isolate STH_CIRM_36]
ATGCCTGAGAAATTAGTTGAAGTAAAAGATGTGGAAATTTCCTTCGGCGAAGGAAGAAAGAAGTTCGTTGCTGTCCACAA
TGCTAATTTTTTCATCAACAAGGGTGAAACCTTCTCCCTCGTTGGTGAGTCTGGTAGTGGTAAAACGACTATTGGACGTG
CCATTATCGGTTTAAATGACACAAGTAATGGTGAGATTATTTTTGACGGTAAGAAGATCAATGGATACTTATCTCACTCT
GAGAAAAACGACCTTATCCGTCGTATTCAGATGATTTTCCAAGACCCTGCGGCTAGTTTGAATGAACGTGCGACAGTCGA
TTATATCTTGTCTGAGGGCTTGTACAATTTCCATCTTTATAAAGATGAGGAAGAACGTAAGGCTAAAATCAAGGAAATCA
TCAAAGAAGTAGGACTTCTTGAGGAGCACTTAACACGTTACCCTCACGAATTTTCTGGGGGACAACGTCAACGTATCGGG
ATTGCGCGTTCTTTGGTCATGCAGCCTGATTTGGTTATCGCTGATGAACCAATCTCAGCCCTTGACGTGTCAGTTCGTGC
CCAAGTTTTGAATTTGCTTAAGAAATTCCAAAAAGAGTTGGGGTTAACCTATCTCTTTATCGCTCACGATTTGTCAGTGG
TCCGTTTCATTTCTGACCGTATCGCTGTTATCTATAAGGGGACAATCGTGGAAGTTGCTGAGACAGAAGAGCTCTACAAC
AATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTATTCCAGATCCAATCTTGGAACGTAAGAAAGTCTT
GAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAGAAATGGTGGAAGTACGCCCAGGTCACTTCGTTT
GGGGTAACAAGACAGAAATTGAGACTTATCGTAAAGAACAAAGTAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7CIU5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

100

100

1

  amiF Streptococcus thermophilus LMD-9

99.676

100

0.997

  amiF Streptococcus salivarius strain HSISS4

98.058

100

0.981


Multiple sequence alignment