Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   ACOGJJ_RS17970 Genome accession   NZ_CP184769
Coordinates   3549069..3549848 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain JG8     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3523796..3585533 3549069..3549848 within 0


Gene organization within MGE regions


Location: 3523796..3585533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACOGJJ_RS17860 (ACOGJJ_17860) - 3524367..3525266 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  ACOGJJ_RS17865 (ACOGJJ_17865) pnp 3525418..3527556 (-) 2139 WP_420729103.1 polyribonucleotide nucleotidyltransferase -
  ACOGJJ_RS17870 (ACOGJJ_17870) rpsO 3527717..3527986 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  ACOGJJ_RS17875 (ACOGJJ_17875) ribF 3528087..3529058 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  ACOGJJ_RS17880 (ACOGJJ_17880) truB 3529102..3530025 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  ACOGJJ_RS17885 (ACOGJJ_17885) rbfA 3530112..3530468 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  ACOGJJ_RS17890 (ACOGJJ_17890) - 3530484..3530765 (-) 282 WP_000582363.1 DUF503 domain-containing protein -
  ACOGJJ_RS17895 (ACOGJJ_17895) infB 3530762..3532822 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  ACOGJJ_RS17900 (ACOGJJ_17900) - 3532827..3533138 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  ACOGJJ_RS17905 (ACOGJJ_17905) rnpM 3533139..3533411 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  ACOGJJ_RS17910 (ACOGJJ_17910) nusA 3533423..3534529 (-) 1107 WP_420729104.1 transcription termination factor NusA -
  ACOGJJ_RS17915 (ACOGJJ_17915) rimP 3534547..3535017 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  ACOGJJ_RS17920 (ACOGJJ_17920) - 3535354..3539655 (-) 4302 WP_199630558.1 PolC-type DNA polymerase III -
  ACOGJJ_RS17925 (ACOGJJ_17925) - 3539780..3541480 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  ACOGJJ_RS17930 (ACOGJJ_17930) rseP 3541590..3542846 (-) 1257 WP_140158244.1 RIP metalloprotease RseP -
  ACOGJJ_RS17935 (ACOGJJ_17935) dxr 3542864..3544006 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  ACOGJJ_RS17940 (ACOGJJ_17940) cdsA 3544030..3544821 (-) 792 WP_199630557.1 phosphatidate cytidylyltransferase -
  ACOGJJ_RS17945 (ACOGJJ_17945) uppS 3544839..3545615 (-) 777 WP_000971296.1 isoprenyl transferase -
  ACOGJJ_RS17950 (ACOGJJ_17950) frr 3545701..3546258 (-) 558 WP_000531501.1 ribosome recycling factor -
  ACOGJJ_RS17955 (ACOGJJ_17955) pyrH 3546261..3546983 (-) 723 WP_000042668.1 UMP kinase -
  ACOGJJ_RS17960 (ACOGJJ_17960) tsf 3547050..3547937 (-) 888 WP_001018578.1 translation elongation factor Ts -
  ACOGJJ_RS17965 (ACOGJJ_17965) rpsB 3548020..3548721 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  ACOGJJ_RS17970 (ACOGJJ_17970) codY 3549069..3549848 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  ACOGJJ_RS17975 (ACOGJJ_17975) hslU 3549926..3551317 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  ACOGJJ_RS17980 (ACOGJJ_17980) hslV 3551340..3551882 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  ACOGJJ_RS17985 (ACOGJJ_17985) xerC 3551925..3552824 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  ACOGJJ_RS17990 (ACOGJJ_17990) trmFO 3552890..3554194 (-) 1305 WP_000213003.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  ACOGJJ_RS17995 (ACOGJJ_17995) topA 3554243..3556321 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  ACOGJJ_RS18000 (ACOGJJ_18000) dprA 3556466..3557335 (-) 870 WP_000818061.1 DNA-processing protein DprA -
  ACOGJJ_RS18005 (ACOGJJ_18005) sucD 3557424..3558326 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  ACOGJJ_RS18010 (ACOGJJ_18010) sucC 3558346..3559506 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  ACOGJJ_RS18015 (ACOGJJ_18015) - 3559701..3560474 (-) 774 WP_001194265.1 ribonuclease HII -
  ACOGJJ_RS18020 (ACOGJJ_18020) ylqF 3560531..3561421 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  ACOGJJ_RS18025 (ACOGJJ_18025) lepB 3561442..3561993 (-) 552 WP_000711853.1 signal peptidase I -
  ACOGJJ_RS18030 (ACOGJJ_18030) rplS 3562095..3562439 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  ACOGJJ_RS18035 (ACOGJJ_18035) trmD 3562586..3563320 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ACOGJJ_RS18040 (ACOGJJ_18040) rimM 3563320..3563835 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  ACOGJJ_RS18045 (ACOGJJ_18045) - 3563957..3564184 (-) 228 WP_000737401.1 KH domain-containing protein -
  ACOGJJ_RS18050 (ACOGJJ_18050) rpsP 3564199..3564471 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  ACOGJJ_RS18055 (ACOGJJ_18055) ffh 3564573..3565922 (-) 1350 WP_000863460.1 signal recognition particle protein -
  ACOGJJ_RS18060 (ACOGJJ_18060) - 3565935..3566267 (-) 333 WP_000891062.1 putative DNA-binding protein -
  ACOGJJ_RS18065 (ACOGJJ_18065) ftsY 3566401..3567390 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  ACOGJJ_RS18070 (ACOGJJ_18070) smc 3567406..3570975 (-) 3570 WP_000478973.1 chromosome segregation protein SMC -
  ACOGJJ_RS18075 (ACOGJJ_18075) rncS 3571122..3571859 (-) 738 WP_001146875.1 ribonuclease III -
  ACOGJJ_RS18080 (ACOGJJ_18080) acpP 3571918..3572151 (-) 234 WP_000786062.1 acyl carrier protein -
  ACOGJJ_RS18085 (ACOGJJ_18085) fabG 3572221..3572961 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  ACOGJJ_RS18090 (ACOGJJ_18090) fabD 3572961..3573905 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  ACOGJJ_RS18095 (ACOGJJ_18095) plsX 3573920..3574912 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  ACOGJJ_RS18100 (ACOGJJ_18100) fapR 3574909..3575502 (-) 594 WP_000747348.1 transcription factor FapR -
  ACOGJJ_RS18105 (ACOGJJ_18105) recG 3575591..3577639 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  ACOGJJ_RS18110 (ACOGJJ_18110) - 3577930..3579606 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  ACOGJJ_RS18115 (ACOGJJ_18115) - 3579629..3579991 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  ACOGJJ_RS18120 (ACOGJJ_18120) rpmB 3580368..3580556 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  ACOGJJ_RS18125 (ACOGJJ_18125) spoVM 3580629..3580709 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  ACOGJJ_RS18130 (ACOGJJ_18130) - 3580776..3581456 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  ACOGJJ_RS18135 (ACOGJJ_18135) rpe 3581525..3582169 (-) 645 WP_071741402.1 ribulose-phosphate 3-epimerase -
  ACOGJJ_RS18140 (ACOGJJ_18140) rsgA 3582172..3583053 (-) 882 WP_065212078.1 ribosome small subunit-dependent GTPase A -
  ACOGJJ_RS18145 (ACOGJJ_18145) pknB 3583300..3585273 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=1111185 ACOGJJ_RS17970 WP_000421290.1 3549069..3549848(-) (codY) [Bacillus cereus strain JG8]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=1111185 ACOGJJ_RS17970 WP_000421290.1 3549069..3549848(-) (codY) [Bacillus cereus strain JG8]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment