Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   DP15_RS05685 Genome accession   NZ_CP008926
Coordinates   1107313..1107597 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain ATCC 19615     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1102313..1112597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DP15_RS05660 (DP15_1168) - 1104259..1104624 (+) 366 WP_002986560.1 DUF1033 family protein -
  DP15_RS05665 (DP15_1169) comGA 1104717..1105655 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  DP15_RS05670 (DP15_1170) comGB 1105591..1106625 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  DP15_RS05675 (DP15_1171) comGC 1106627..1106953 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  DP15_RS05680 (DP15_1172) comGD 1106928..1107356 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  DP15_RS05685 (DP15_1173) comGE 1107313..1107597 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  DP15_RS05690 (DP15_1174) comGF 1107590..1108024 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  DP15_RS05695 (DP15_1175) comGG 1108008..1108334 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  DP15_RS05700 (DP15_1176) comGH 1108432..1109385 (+) 954 WP_023610092.1 class I SAM-dependent methyltransferase Machinery gene
  DP15_RS05705 (DP15_1177) - 1109444..1110640 (+) 1197 WP_002992742.1 acetate kinase -
  DP15_RS05710 - 1110827..1111135 (+) 309 WP_032467031.1 hypothetical protein -
  DP15_RS05715 (DP15_1178) proC 1111218..1111988 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=110968 DP15_RS05685 WP_011284422.1 1107313..1107597(+) (comGE) [Streptococcus pyogenes strain ATCC 19615]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=110968 DP15_RS05685 WP_011284422.1 1107313..1107597(+) (comGE) [Streptococcus pyogenes strain ATCC 19615]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment