Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   ACLB1F_RS11715 Genome accession   NZ_CP177161
Coordinates   2440671..2440937 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain ZJ5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435671..2445937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLB1F_RS11665 (ACLB1F_11665) sinR 2435834..2436169 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACLB1F_RS11670 (ACLB1F_11670) tasA 2436217..2437002 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACLB1F_RS11675 (ACLB1F_11675) sipW 2437067..2437651 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACLB1F_RS11680 (ACLB1F_11680) tapA 2437623..2438294 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACLB1F_RS11685 (ACLB1F_11685) - 2438553..2438882 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACLB1F_RS11690 (ACLB1F_11690) - 2438923..2439102 (-) 180 WP_022552966.1 YqzE family protein -
  ACLB1F_RS11695 (ACLB1F_11695) comGG 2439159..2439536 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACLB1F_RS11700 (ACLB1F_11700) comGF 2439537..2440037 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACLB1F_RS11705 (ACLB1F_11705) comGE 2439946..2440260 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACLB1F_RS11710 (ACLB1F_11710) comGD 2440244..2440681 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACLB1F_RS11715 (ACLB1F_11715) comGC 2440671..2440937 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACLB1F_RS11720 (ACLB1F_11720) comGB 2440984..2442021 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACLB1F_RS11725 (ACLB1F_11725) comGA 2442008..2443078 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACLB1F_RS11730 (ACLB1F_11730) - 2443275..2444225 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  ACLB1F_RS11735 (ACLB1F_11735) - 2444371..2445672 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=1085651 ACLB1F_RS11715 WP_042635730.1 2440671..2440937(-) (comGC) [Bacillus velezensis strain ZJ5]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=1085651 ACLB1F_RS11715 WP_042635730.1 2440671..2440937(-) (comGC) [Bacillus velezensis strain ZJ5]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment