Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BSUA_RS13410 Genome accession   NZ_CP007800
Coordinates   2529687..2530034 (-) Length   115 a.a.
NCBI ID   WP_003230165.1    Uniprot ID   P25957
Organism   Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2524687..2535034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUA_RS13365 (BSUA_02635) sinI 2525212..2525385 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSUA_RS13370 (BSUA_02636) sinR 2525419..2525754 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSUA_RS13375 (BSUA_02637) tasA 2525847..2526632 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BSUA_RS13380 (BSUA_02638) sipW 2526696..2527268 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BSUA_RS13385 (BSUA_02639) tapA 2527252..2528013 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BSUA_RS13390 (BSUA_02640) yqzG 2528285..2528611 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSUA_RS13395 (BSUA_02641) spoIITA 2528653..2528832 (-) 180 WP_003230176.1 YqzE family protein -
  BSUA_RS13400 (BSUA_02642) comGG 2528903..2529277 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BSUA_RS13405 (BSUA_02643) comGF 2529278..2529661 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BSUA_RS13410 (BSUA_02644) comGE 2529687..2530034 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  BSUA_RS13415 (BSUA_02645) comGD 2530018..2530449 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  BSUA_RS13420 (BSUA_02646) comGC 2530439..2530735 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSUA_RS13425 (BSUA_02647) comGB 2530749..2531786 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  BSUA_RS13430 (BSUA_02648) comGA 2531773..2532843 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSUA_RS13440 (BSUA_02650) corA 2533255..2534208 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13271.33 Da        Isoelectric Point: 5.1901

>NTDB_id=107956 BSUA_RS13410 WP_003230165.1 2529687..2530034(-) (comGE) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAASKTITKNNHIYAMK
WEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=107956 BSUA_RS13410 WP_003230165.1 2529687..2530034(-) (comGE) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTGTGCTGCTGACAGT
CGTCCCCTTGTGGGACAAGCTGATGGCTGATGAAAAAATGGCGGAATCACGAGAAATTGGCTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGAGTGGTGAAGGAGCCGCGTCAAAAACGATTACAAAGAACAATCATATCTATGCAATGAAG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGTATCAAAGCCGCAGCTTATAAAGAAAAATCATTTTGCCTCAGCATTTT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25957

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment