Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACI8NS_RS04540 Genome accession   NZ_CP174125
Coordinates   847403..847717 (+) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain AX22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 842403..852717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI8NS_RS04515 (ACI8NS_04515) - 843438..844388 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  ACI8NS_RS04520 (ACI8NS_04520) comGA 844585..845655 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACI8NS_RS04525 (ACI8NS_04525) comGB 845642..846679 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACI8NS_RS04530 (ACI8NS_04530) comGC 846684..846992 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACI8NS_RS04535 (ACI8NS_04535) comGD 846982..847419 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACI8NS_RS04540 (ACI8NS_04540) comGE 847403..847717 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACI8NS_RS04545 (ACI8NS_04545) comGF 847626..848126 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACI8NS_RS04550 (ACI8NS_04550) comGG 848127..848504 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACI8NS_RS04555 (ACI8NS_04555) - 848561..848740 (+) 180 WP_022552966.1 YqzE family protein -
  ACI8NS_RS04560 (ACI8NS_04560) - 848781..849110 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACI8NS_RS04565 (ACI8NS_04565) tapA 849369..850040 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACI8NS_RS04570 (ACI8NS_04570) sipW 850012..850596 (+) 585 WP_032874025.1 signal peptidase I SipW -
  ACI8NS_RS04575 (ACI8NS_04575) tasA 850661..851446 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACI8NS_RS04580 (ACI8NS_04580) sinR 851494..851829 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACI8NS_RS04585 (ACI8NS_04585) sinI 851863..852036 (-) 174 WP_032874029.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=1074451 ACI8NS_RS04540 WP_032874016.1 847403..847717(+) (comGE) [Bacillus velezensis strain AX22]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1074451 ACI8NS_RS04540 WP_032874016.1 847403..847717(+) (comGE) [Bacillus velezensis strain AX22]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment