Detailed information    

experimental Experimentally validated

Overview


Name   H0N27_10825   Type   Auxiliary factor
Locus tag   H0N27_RS10820 Genome accession   NZ_CP059039
Coordinates   2321983..2322225 (+) Length   80 a.a.
NCBI ID   WP_031977334.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain A118     
Function   inhibit foreign DNA acquisition   
Defense system

Function


An A118-specific restriction-modification (RM) system that impairs transformation when the incoming DNA lacks a specific methylation signature.


Genomic Context


Location: 2316983..2327225
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0N27_RS10800 (H0N27_10805) - 2317293..2318357 (-) 1065 WP_001061479.1 catalase family peroxidase -
  H0N27_RS10805 (H0N27_10810) - 2318476..2319102 (-) 627 WP_171945438.1 hypothetical protein -
  H0N27_RS10810 (H0N27_10815) - 2319304..2319906 (-) 603 WP_168726360.1 TetR/AcrR family transcriptional regulator -
  H0N27_RS10815 (H0N27_10820) H0N27_10820 2320713..2321888 (-) 1176 WP_168726361.1 DNA adenine methylase Auxiliary factor
  H0N27_RS10820 (H0N27_10825) H0N27_10825 2321983..2322225 (+) 243 WP_031977334.1 helix-turn-helix domain-containing protein Auxiliary factor
  H0N27_RS10825 (H0N27_10830) H0N27_10830 2322217..2322873 (-) 657 WP_031977331.1 BglII/BstYI family type II restriction endonuclease Auxiliary factor
  H0N27_RS10830 (H0N27_10835) - 2323204..2324445 (+) 1242 WP_168726448.1 anti-phage deoxyguanosine triphosphatase -
  H0N27_RS10835 (H0N27_10840) - 2324592..2324975 (-) 384 WP_001169696.1 PaaI family thioesterase -
  H0N27_RS10840 (H0N27_10845) - 2325053..2325658 (-) 606 WP_168726362.1 DapH/DapD/GlmU-related protein -
  H0N27_RS10845 (H0N27_10850) - 2325645..2326610 (-) 966 WP_168726363.1 PaaX family transcriptional regulator C-terminal domain-containing protein -

Sequence


Protein


Download         Length: 80 a.a.        Molecular weight: 9249.85 Da        Isoelectric Point: 6.9483

>NTDB_id=1049 H0N27_RS10820 WP_031977334.1 2321983..2322225(+) (H0N27_10825) [Acinetobacter baumannii strain A118]
MDKNLMKSLCVQALKQMRLDAQLTQSQLAKMLNKPQSFVSKYENGDRALEISEVYLICKKLNKSLLDFEEILESFIHELG

Nucleotide


Download         Length: 243 bp        

>NTDB_id=1049 H0N27_RS10820 WP_031977334.1 2321983..2322225(+) (H0N27_10825) [Acinetobacter baumannii strain A118]
ATGGATAAAAATTTAATGAAGTCTTTATGTGTACAAGCTTTAAAACAAATGAGGCTAGATGCACAACTAACACAATCACA
GTTAGCTAAAATGCTTAATAAGCCTCAAAGTTTTGTATCTAAATACGAAAATGGAGATAGAGCTTTAGAAATTTCAGAAG
TATATTTGATCTGTAAAAAATTAAACAAATCACTCTTAGACTTTGAGGAAATTTTAGAAAGTTTTATTCATGAATTAGGT
TAA

Domains


Predicted by InterProScan.

(14-67)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Nina Vesel et al. (2023) DNA modifications impact natural transformation of Acinetobacter baumannii. Nucleic Acids Research 51(11):5661-5677. [PMID: 37178001]