Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   KHU1_RS10650 Genome accession   NZ_CP007242
Coordinates   2275466..2275780 (-) Length   104 a.a.
NCBI ID   WP_007408323.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens KHG19     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2270466..2280780
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHU1_RS10605 (KHU1_2079) sinI 2271148..2271321 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KHU1_RS10610 (KHU1_2080) sinR 2271355..2271690 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHU1_RS10615 (KHU1_2081) tasA 2271738..2272523 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KHU1_RS10620 (KHU1_2082) sipW 2272588..2273172 (-) 585 WP_007408328.1 signal peptidase I SipW -
  KHU1_RS10625 (KHU1_2083) tapA 2273144..2273815 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  KHU1_RS10630 (KHU1_2084) - 2274074..2274403 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KHU1_RS10635 (KHU1_2085) - 2274443..2274622 (-) 180 WP_003153093.1 YqzE family protein -
  KHU1_RS10640 (KHU1_2086) comGG 2274679..2275056 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHU1_RS10645 (KHU1_2087) comGF 2275057..2275557 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  KHU1_RS10650 (KHU1_2088) comGE 2275466..2275780 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE Machinery gene
  KHU1_RS10655 (KHU1_2089) comGD 2275764..2276201 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  KHU1_RS10660 (KHU1_2090) comGC 2276191..2276499 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KHU1_RS10665 (KHU1_2091) comGB 2276504..2277541 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  KHU1_RS10670 (KHU1_2092) comGA 2277528..2278598 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  KHU1_RS10675 (KHU1_2093) - 2278790..2279740 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11913.91 Da        Isoelectric Point: 7.1308

>NTDB_id=103640 KHU1_RS10650 WP_007408323.1 2275466..2275780(-) (comGE) [Bacillus amyloliquefaciens KHG19]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRHEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=103640 KHU1_RS10650 WP_007408323.1 2275466..2275780(-) (comGE) [Bacillus amyloliquefaciens KHG19]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACTGATGGTCTGAAAATAGAAGATCGCCATGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471