Detailed information of relaxase

Relaxase

ID   200 GenBank   AAL59457
Name   Orf57_pAD1 insolico UniProt ID   Q8VT37
Family   MOBC PDB ID   _
Length   216 a.a.
Note   Replication-relaxation; pfam13814

  Protein sequence


Download         Length: 216 a.a.        Molecular weight: 26040.98 Da        Isoelectric Point: 8.3546

>AAL59457.1 unknown (plasmid) [Enterococcus faecalis]
MAKKSSVYGNLKKLKEKNLVECSQIGSTKFYYLTKEGHNYIGGYYTLPKVPEYNLQHHLQINDYLIKMLE
LCNNHPHLKAVVSERRKVYEVKDEKKNQKGVKYFVPDFIFMFLDSIGREVEWQFEIELTLKTKRRYSQGV
FPKYIKHLKNYEDARLIYVTPSSIIKEELDMFKEYFIDKEGDEYKEVFDRLHVFSAEEFESELKRLLEKD
KFINWE

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB Q8VT37

  Reference


[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
[3] Francia MV et al. (2001) Completion of the nucleotide sequence of the Enterococcus faecalis conjugative virulence plasmid pAD1 and identification of a second transfer origin. Plasmid. 46(2):117-27. [PMID:11591137]