Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200558
Name   oriT_IME_FprA2-165_NS_5 in_silico
Organism   Faecalibacterium duncaniae strain JCM 31915
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   CP048437 (_)
oriT length   35 nt
IRs (inverted repeats)      5..11, 15..21  (ACTTTGC..GCAAAGT)
Location of nic site      29..30
Conserved sequence flanking the
  nic site  
 
 GTGTGTTATA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 35 nt

>oriT_IME_FprA2-165_NS_5
CACGACTTTGCGAAGCAAAGTGTAGTGTGTTATAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14586 GenBank   QIA44183
Name   Mob_Pre_GXM22_14565_IME_FprA2-165_NS_5 insolico UniProt ID   _
Length   314 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 314 a.a.        Molecular weight: 36343.77 Da        Isoelectric Point: 10.4574

>QIA44183.1 plasmid recombination protein [Faecalibacterium duncaniae]
MAQHAILRFEKHKGNPARPLEAHHERQKEQYASNPDIDTSRSKYNFHIVKPEGRYYHFIQSRIEQAGCRT
RKDSTRFVDTLITASPEFFKGKSPKEIQAFFQRAADFLIGRVGRENIVSAVVHMDEKTPHLHLTFVPLTK
DNRLCAKEIIGNRANLTKWQDDFHAYMVVKYPDLERGESASKTGRKHIPTRLFKQAVFLSKQARAIEAAL
DGINPLNAGKKKEEALSMLKKWFPQMENFSGQLKKYKVTINDLLAENEKLEARAKASEKGKMKDTMERAK
LKSELDNLQRLVDRIPPDILAELKRQQRHTVKER

  Protein domains


Predicted by InterproScan.

(1-194)


  Protein structure



No available structure.




T4CP


ID   17204 GenBank   QIA44176
Name   t4cp2_GXM22_14525_IME_FprA2-165_NS_5 insolico UniProt ID   _
Length   589 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 589 a.a.        Molecular weight: 66961.90 Da        Isoelectric Point: 7.6385

>QIA44176.1 type IV secretory system conjugative DNA transfer family protein [Faecalibacterium duncaniae]
MNKPDMKKLILLNLPYVFAFYFADKIAAVFRLAPGAEFIDKLTNGFAVFGTAFANPLPSFHPVDLLIGLS
AGVLLKLAVYVKGKNRKKFRQGEEYGSARWGKPEDIKPYMDPEFSNNVILTQTEFLTMNSRPKQPKYARN
KNILVIGGSGSGKTRFFVKPNLMQMHSSYVVTDPKGTVLVECGKMLEKGGYVIKSLNTINFRKSMHYNPF
SYIRSEKDILKLVNTIIVNTKGDGDKSGEDFWVKAEKLYYTALIGYIWYEAPDHEKNFTTLLEMINASEA
REDDETFKNPVDVMFDELEARDPDHFAVKQYRKYKLAAGKTAKSILISCGARLAPFDIAELRELMSYDEM
ELDTIGDRKTALFVIISDTDDTFNFVVAIMYSQLFNLLCDKADDVYNGRLPVHVRCLLDEFANIGQIPKF
DKLIATIRSREISASIILQSQSQLKTIYKDAADTITGNCDCTLFLGGKEKSTLKEISEVLGKETIDLYNT
SETRSNNNSYGLNYQKTGKELMSQDEIAVMDGAKCILQLRGVRPFLSNKYDITKHPKYRQLSDYNKRNAF
DIEKYRQHKLVVKLDDTFDLYDMGEVEAD

  Protein domains


Predicted by InterproScan.

(137-539)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1762683..1784231

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GXM22_08600 1759175..1760038 + 864 QIA43124 AraC family transcriptional regulator -
GXM22_08605 1760067..1761440 + 1374 QIA43125 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
GXM22_08610 1761668..1762582 + 915 QIA43126 helix-turn-helix domain-containing protein -
GXM22_08615 1762683..1763153 + 471 QIA43127 PcfB family protein cd411
GXM22_08620 1763150..1764955 + 1806 QIA43128 type IV secretory system conjugative DNA transfer family protein -
GXM22_08625 1765003..1765143 + 141 QIA43129 hypothetical protein prgF
GXM22_08630 1765348..1765725 + 378 QIA43130 GntR family transcriptional regulator -
GXM22_08635 1765728..1766588 + 861 QIA43131 ABC transporter ATP-binding protein -
GXM22_08640 1766585..1767232 + 648 QIA43132 ABC-2 transporter permease -
GXM22_08645 1767573..1768016 + 444 QIA43133 sigma-70 family RNA polymerase sigma factor -
GXM22_08650 1768009..1768209 + 201 QIA43134 helix-turn-helix domain-containing protein -
GXM22_08655 1768676..1769101 + 426 QIA44349 plasmid mobilization relaxosome protein MobC -
GXM22_08660 1769160..1770693 + 1534 Protein_1688 relaxase/mobilization nuclease domain-containing protein -
GXM22_08665 1770867..1771061 + 195 QIA44350 hypothetical protein -
GXM22_08670 1771051..1771791 + 741 QIA43135 replication protein -
GXM22_08675 1771788..1772627 + 840 QIA43136 ATP-binding protein -
GXM22_08680 1772640..1772831 + 192 QIA43137 hypothetical protein -
GXM22_08685 1772966..1774573 + 1608 QIA43138 DUF4368 domain-containing protein -
GXM22_08690 1774592..1774756 + 165 Protein_1694 hypothetical protein -
GXM22_08695 1774860..1775525 + 666 QIA43139 hypothetical protein prgHa
GXM22_08700 1776101..1777933 + 1833 QIA43140 group II intron reverse transcriptase/maturase -
GXM22_08705 1778009..1778311 + 303 QIA43141 hypothetical protein prgHa
GXM22_08710 1778332..1778757 + 426 QIA43142 PrgI family protein prgIa
GXM22_08715 1778684..1781086 + 2403 QIA43143 PrgI family protein virb4
GXM22_08720 1781083..1781979 + 897 QIA43144 DNA (cytosine-5-)-methyltransferase -
GXM22_08725 1781976..1783961 + 1986 QIA43145 C40 family peptidase cd419a
GXM22_08730 1783980..1784231 + 252 QIA43146 DUF4315 family protein cd419
GXM22_08735 1784221..1784943 + 723 QIA43147 DUF4366 domain-containing protein -
GXM22_08740 1784940..1787063 + 2124 QIA43148 DNA topoisomerase III -

Region 2: 2998030..3009698

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GXM22_14455 2994438..2995241 - 804 QIA44164 phosphoadenosine phosphosulfate reductase -
GXM22_14460 2995192..2997261 - 2070 QIA44165 DNA topoisomerase III -
GXM22_14465 2997258..2998037 - 780 QIA44166 DUF4366 domain-containing protein -
GXM22_14470 2998030..2998266 - 237 QIA44167 DUF4315 family protein cd419
GXM22_14475 2998283..3000490 - 2208 QIA44168 peptidase M23 cd419a
GXM22_14480 3000490..3001443 - 954 QIA44410 site-specific DNA-methyltransferase -
GXM22_14485 3001472..3002047 - 576 QIA44169 nitrogen fixation protein -
GXM22_14490 3002063..3004462 - 2400 QIA44411 conjugal transfer protein TraE virb4
GXM22_14495 3004464..3004844 - 381 QIA44170 PrgI family protein prgIa
GXM22_14500 3004813..3005301 - 489 QIA44171 hypothetical protein -
GXM22_14505 3005289..3005882 - 594 QIA44172 adenine methyltransferase -
GXM22_14510 3005872..3006741 - 870 QIA44173 hypothetical protein prgHa
GXM22_14515 3006781..3006996 - 216 QIA44174 conjugal transfer protein prgF
GXM22_14520 3007091..3007306 - 216 QIA44175 conjugal transfer protein prgF
GXM22_14525 3007441..3009210 - 1770 QIA44176 type IV secretory system conjugative DNA transfer family protein virb4
GXM22_14530 3009207..3009698 - 492 QIA44177 PcfB family protein cd411
GXM22_14535 3009829..3010734 - 906 QIA44178 helix-turn-helix domain-containing protein -
GXM22_14540 3010731..3011504 - 774 QIA44179 toxin Bro -
GXM22_14545 3011497..3011745 - 249 QIA44180 hypothetical protein -
GXM22_14550 3011872..3012180 - 309 QIA44181 thiamine transporter -
GXM22_14555 3012334..3012549 - 216 Protein_2833 recombinase family protein -
GXM22_14560 3012695..3012889 - 195 QIA44182 hypothetical protein -
GXM22_14565 3012962..3013906 - 945 QIA44183 plasmid recombination protein -
GXM22_14570 3013878..3014065 - 188 Protein_2836 hypothetical protein -
GXM22_14575 3014090..3014485 - 396 QIA44184 replication initiator protein A -


Host bacterium


ID   272 Element type   ICE (Integrative and conjugative element)
Element name   ICE_FprA2-165_rumA GenBank   CP048437
Element size   3102523 bp Coordinate of oriT [Strand]   33130..33157 [+]
Host bacterium   Faecalibacterium duncaniae strain JCM 31915 Coordinate of element   1761411..1808878

Cargo genes


Drug resistance gene   ant(6)-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21, AcrIIA9