Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200549
Name   oriT_SGI1-B2 in_silico
Organism   Proteus mirabilis strain PmSC17 Salmonella
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   KP116299 (30640..30763 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      65..70, 76..81  (CGGGGG..CCCCCG)
 43..49, 51..57  (CCTTGAG..CTCAAGG)
 8..14, 19..25  (CGCGCAC..GTGCGCG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_SGI1-B2
TATAATTCGCGCACATTCGTGCGCGGTGCGAAAGCCTAGAGCCCTTGAGGCTCAAGGCTTCCGTCGGGGGCTCTACCCCCGTCTCTGTTTACGCCTACGGCGACAGAGACGGGGTGGAGCATAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14584 GenBank   AJS16039
Name   Replic_Relax_-_SGI1-B2 insolico UniProt ID   _
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>AJS16039.1 PadR family transcriptional regulator [Proteus mirabilis]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure



No available structure.




Host bacterium

ID   491 Element type   IME (Integrative mobilizable element)
Element name   SGI1-B2 GenBank   KP116299
Element size   48650 bp Coordinate of oriT [Strand]   30640..30763 [+]
Host bacterium   Proteus mirabilis strain PmSC17 Salmonella Coordinate of element   139..46067

Cargo genes

Drug resistance gene   dfrA17, aadA5, qacE, sul1, mph(A), blaCARB-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -