Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200496
Name   oriT_ICEBpSAFR-032 in_silico
Organism   Bacillus pumilus SAFR-032
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_009848 (6282..6305 [+], 24 nt)
oriT length   24 nt
IRs (inverted repeats)      1..7, 18..24  (ACCCCCC..GGGGGGT)
 3..8, 18..23  (CCCCCC..GGGGGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 24 nt

>oriT_ICEBpSAFR-032
ACCCCCCCACGCTAACAGGGGGGT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14536 GenBank   WP_012009099
Name   Rep_trans_BPUM_RS02920_ICEBpSAFR-032 insolico UniProt ID   A8FAI1
Length   366 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 366 a.a.        Molecular weight: 42620.80 Da        Isoelectric Point: 8.2711

>WP_012009099.1 replication initiation factor domain-containing protein [Bacillus pumilus]
MTGKVKPPHANRGVLRKKEEEKSQLTSMVDYVRISFKTHDIDHIIQNVLHINREFMTEEPRGFYGYIGTW
RMDMIKVFYSAPDDERGTLIELSGKGCRQFESFLECRGKTWFDFFQDCLNEKGNFTRLDIAIDDKKTYFS
IPNLLKRVQKGLCVSRYRRVDNNGSNQIEDGSSAGTTIYFGSKKSESYLCFYEKNYEQADKFNLSYDDLE
KWNRYEIRLKSERAHSAVCALIADRNLKKIAIGIISNCIRFVEEKGEGDKRKRKTSPFWLKFIGDVEKLQ
LTIEPKKDFYEKSRNWLQNSCAPTMKVILEVDRVLGNSRLLDVILNAEEGALGDSDLLNMIFNAKLQDKH
EKMLETFLTPIHEMVV

  Protein domains


Predicted by InterproScan.

Replication initiation factor (Rep_trans)

(123-320)

Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N)

(27-116)


  Protein structure


Source ID Structure
AlphaFold DB A8FAI1


T4CP

ID   17155 GenBank   WP_275477915
Name   tcpA_BPUM_RS02915_ICEBpSAFR-032 insolico UniProt ID   _
Length   417 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 417 a.a.        Molecular weight: 48548.64 Da        Isoelectric Point: 9.3235

>WP_275477915.1 FtsK/SpoIIIE domain-containing protein [Bacillus pumilus]
MPVFLLLMILFWRSHLWDVYEKGIEDTFENFTFNIPLIVKSLLVSIIVPVALILVWYFIFHQSYKKIYHR
QKIARMIFSNKFYESKSVRSKITEKTVQKISYFPKFYYRVKDNHIIIKIAMDMSRFQQRFMELGREFENG
LFCDLVSTDMEDGYFTYKLLYDAGRNRIGINEAIVEKGSMTLMKHIKWEFDKLPHMLISGGTGGGKTYFI
LTLVKSLVASGADVRILDPKNADLADLEEVLEGKVFSRKNGIMMTLRKSVEDMMRRMDEMKNHPNYRTGE
NYAFLGYKPVFIVFDEFVAFVDMLDFKERESVIQDIKQIVMLGRQAGFFLVAGAQRPDAKYFADGIRDQF
NFRISLGKMSETGYAMLFGDTDKKFVEKDIKGRGYAYAGTGNIMEFYSPLIPNGYDFIEEIRLAKGA

  Protein domains


Predicted by InterproScan.

FtsK/SpoIIIE family (FtsK_SpoIIIE)

(186-339)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 591669..615545

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BPUM_RS02885 (BPUM_0549) 588472..589590 + 1119 WP_012009094 AimR family lysis-lysogeny pheromone receptor -
BPUM_RS19080 589587..589724 + 138 WP_158511373 hypothetical protein -
BPUM_RS02890 (BPUM_0550) 589910..590296 - 387 WP_012009095 helix-turn-helix transcriptional regulator -
BPUM_RS02900 (BPUM_0552) 590737..590979 + 243 WP_012009096 hypothetical protein -
BPUM_RS19280 591038..591211 + 174 WP_225970053 hypothetical protein -
BPUM_RS02905 (BPUM_03955) 591669..592052 + 384 WP_041815229 YdcP family protein orf23
BPUM_RS02910 (BPUM_0553) 592338..593294 + 957 WP_041815231 hypothetical protein -
BPUM_RS02915 (BPUM_0554) 593409..594662 + 1254 WP_275477915 FtsK/SpoIIIE domain-containing protein virb4
BPUM_RS02920 (BPUM_0555) 594736..595836 + 1101 WP_012009099 replication initiation factor domain-containing protein -
BPUM_RS02925 (BPUM_0556) 596092..596349 + 258 WP_012009100 ASCH/PUA domain-containing protein -
BPUM_RS02930 (BPUM_0557) 596356..596634 + 279 WP_012009101 hypothetical protein -
BPUM_RS02935 (BPUM_0558) 596713..597363 + 651 WP_012009102 hypothetical protein -
BPUM_RS02940 (BPUM_0559) 597427..599967 + 2541 WP_225970054 thioester domain-containing protein -
BPUM_RS02945 (BPUM_0560) 600356..601180 - 825 WP_012009104 hypothetical protein -
BPUM_RS02950 (BPUM_0561) 601409..602194 + 786 WP_012009105 DNA cytosine methyltransferase -
BPUM_RS02955 (BPUM_0562) 602266..602562 + 297 WP_012009106 hypothetical protein -
BPUM_RS02960 (BPUM_0563) 602552..602833 + 282 WP_012009107 hypothetical protein -
BPUM_RS02965 (BPUM_0564) 602862..603254 + 393 WP_012009108 hypothetical protein -
BPUM_RS02970 (BPUM_0565) 603251..604480 + 1230 WP_012009109 CpaF/VirB11 family protein virB11
BPUM_RS02975 (BPUM_0566) 604467..605279 + 813 WP_012009110 hypothetical protein -
BPUM_RS02980 (BPUM_0567) 605284..606045 + 762 WP_012009111 hypothetical protein -
BPUM_RS02985 (BPUM_0568) 606052..606411 + 360 WP_012009112 hypothetical protein -
BPUM_RS19085 606425..606571 + 147 WP_157840134 hypothetical protein -
BPUM_RS19090 (BPUM_0569) 606593..606751 + 159 WP_157840133 hypothetical protein -
BPUM_RS02995 (BPUM_0571) 607239..608234 + 996 WP_012009115 conjugal transfer protein orf13
BPUM_RS03000 (BPUM_0572) 608246..608506 + 261 WP_012009116 hypothetical protein -
BPUM_RS03005 (BPUM_0573) 608518..608985 + 468 WP_012009117 conjugal transfer protein orf17b
BPUM_RS03010 (BPUM_0574) 608963..611419 + 2457 WP_012009118 ATP-binding protein virb4
BPUM_RS03015 (BPUM_0575) 612190..614571 + 2382 WP_012009119 hypothetical protein orf15
BPUM_RS03020 (BPUM_0576) 614568..615545 + 978 WP_012009120 bifunctional lytic transglycosylase/C40 family peptidase orf14
BPUM_RS03025 (BPUM_0577) 615555..616046 + 492 WP_012009121 hypothetical protein -
BPUM_RS03030 (BPUM_0578) 616074..616283 + 210 WP_012009122 DUF3173 domain-containing protein -
BPUM_RS03035 (BPUM_0579) 616280..616492 + 213 WP_041815235 hypothetical protein -
BPUM_RS03040 (BPUM_0580) 616489..617766 + 1278 WP_012009123 tyrosine-type recombinase/integrase -
BPUM_RS03045 (BPUM_0581) 618040..619098 - 1059 WP_012009124 AraC family transcriptional regulator -

Host bacterium

ID   441 Element type   ICE (Integrative and conjugative element)
Element name   ICEBpSAFR-032 GenBank   NC_009848
Element size   3704641 bp Coordinate of oriT [Strand]   6282..6305 [+]
Host bacterium   Bacillus pumilus SAFR-032 Coordinate of element   588472..617766

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -