Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200470 |
| Name | oriT_ICESpn6706B-1 |
| Organism | Streptococcus pneumoniae 670-6B |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | CP002176 (49102..49234 [-], 133 nt) |
| oriT length | 133 nt |
| IRs (inverted repeats) | 65..70, 83..88 (AAATCC..GGATTT) 4..11, 23..30 (TACCCCCC..GGGGGGTA) 7..12, 23..28 (CCCCCC..GGGGGG) |
| Location of nic site | 75..76 |
| Conserved sequence flanking the nic site |
TTTGGTTACA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 133 nt
ACTTACCCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATAC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 14499 | GenBank | ADM91230 |
| Name | Rep_trans_SP670_1167_ICESpn6706B-1 |
UniProt ID | _ |
| Length | 472 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 472 a.a. Molecular weight: 55639.89 Da Isoelectric Point: 8.3884
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKKGYLSTIPVDRYPKKDIMGD
KTVRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVHYLKILYNRN
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Auxiliary protein
| ID | 7917 | GenBank | ADM91214 |
| Name | ADM91214_ICESpn6706B-1 |
UniProt ID | _ |
| Length | 361 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 361 a.a. Molecular weight: 41653.86 Da Isoelectric Point: 9.5342
MATDLVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILK
KDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDD
TVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDT
EIGYYIETPKTKSGERQVPMVEEAYQAFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKG
LVKKYNKYNEDKLPHITPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRL
NKEKQQERLVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4CP
| ID | 17107 | GenBank | ADM91231 |
| Name | tcpA_SP670_1168_ICESpn6706B-1 |
UniProt ID | _ |
| Length | 461 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 461 a.a. Molecular weight: 53370.27 Da Isoelectric Point: 9.0687
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
| ID | 17108 | GenBank | ADM91250 |
| Name | t4cp2_SP670_1187_ICESpn6706B-1 |
UniProt ID | _ |
| Length | 625 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 625 a.a. Molecular weight: 72493.87 Da Isoelectric Point: 9.6098
MYSGKKFLLFSLLGILLGYLFHRLTLLYDSYTGNTLDKWTHLLMEGQDEVLQSPWNVSFTGKSSAFFLLG
FVMMLLVYLYLETGKKQYREGVEYGSARFGTLKEKKLFYGKEFSHDTILAQDVRLTLLDKKPPQYDRNKN
IAVIGGSGSGKTFRFVKPNLIQMNSSNIVVDPKDHLAEKTGKLFLERGYQVKVLDLVNMKNSDGFNPFRY
IETENDLNRMLTVYFNNTKGSGSRSDPFWDEASMTLVRALASYLVDFYNPPKTREQLIEESRLSQKEYQN
LLKRQKKEVEERKKRGRYPSFAEISKLIKHLSKGENQEKSVLEILFENYAKKYGTENFTMRNWADFQNYK
DKTLDSVIAVTTAKFALFNIQSVMDLTKRDTLDMKTWGQEKSMVYLVIPDNDSTFRFLSALFFSTVFQTL
TRQADIDFKGQLPLHVRVYLDEFANIGEIPDFAEQTSTVRSRNMSLVPILQNIAQLQGLYKEKEAWKTIL
GNCDSLVYLGGNDEDTFKFMSGLLGKQTIDVRNTSRSFGQTGSGSLSHQKIARDLMTPDEIGNMKRHECL
VRIANMPVFKSKKYYSTKHPNWKYLANQETDERWWNYQINPLNQRQENHLEGLRIRDLTFESSLK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1055866..1117729
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP670_1126 | 1051263..1052513 | - | 1251 | ADM91189 | conserved hypothetical protein | - |
| SP670_1127 | 1052607..1053503 | + | 897 | ADM91190 | tyrosine recombinase | - |
| SP670_1128 | 1053880..1054260 | - | 381 | ADM91191 | zeta toxin superfamily | - |
| SP670_1129 | 1054321..1054500 | + | 180 | ADM91192 | conserved domain protein | - |
| SP670_1130 | 1054621..1054848 | - | 228 | ADM91193 | hypothetical protein | - |
| SP670_1131 | 1054839..1055471 | - | 633 | ADM91194 | hypothetical protein | - |
| SP670_1132 | 1055553..1055828 | - | 276 | ADM91195 | conserved hypothetical protein | - |
| SP670_1133 | 1055866..1056249 | - | 384 | ADM91196 | conserved hypothetical protein | gbs1346 |
| SP670_1134 | 1056246..1056479 | - | 234 | ADM91197 | conserved hypothetical protein | gbs1347 |
| SP670_1135 | 1056530..1057615 | - | 1086 | ADM91198 | conserved hypothetical protein | traP |
| SP670_1136 | 1057625..1058266 | - | 642 | ADM91199 | conserved hypothetical protein | prgL |
| SP670_1137 | 1058594..1058968 | - | 375 | ADM91200 | choline transport ATP-binding protein opuBA | - |
| SP670_1138 | 1059308..1060153 | + | 846 | ADM91201 | replication protein | - |
| SP670_1139 | 1061018..1061668 | - | 651 | ADM91202 | chloramphenicol O-acetyltransferase | - |
| SP670_1140 | 1061839..1062087 | - | 249 | ADM91203 | hypothetical protein | - |
| SP670_1141 | 1062335..1063141 | - | 807 | ADM91204 | hypothetical protein | - |
| SP670_1142 | 1063602..1064372 | - | 771 | ADM91205 | zeta toxin | - |
| SP670_1143 | 1064372..1064848 | - | 477 | ADM91206 | helix-turn-helix domain protein | - |
| SP670_1144 | 1064919..1065191 | - | 273 | ADM91207 | conserved hypothetical protein | - |
| SP670_1145 | 1065229..1065612 | - | 384 | ADM91208 | conserved hypothetical protein | gbs1346 |
| SP670_1146 | 1065609..1065842 | - | 234 | ADM91209 | conserved hypothetical protein | gbs1347 |
| SP670_1147 | 1065893..1066978 | - | 1086 | ADM91210 | PcfD | traP |
| SP670_1148 | 1066988..1067629 | - | 642 | ADM91211 | conserved hypothetical protein | prgL |
| SP670_1149 | 1068804..1069688 | + | 885 | ADM91212 | positive transcriptional regulator MutR family | - |
| SP670_1150 | 1069651..1070331 | - | 681 | ADM91213 | hypothetical protein | - |
| SP670_1151 | 1070508..1071593 | - | 1086 | ADM91214 | integrase | - |
| SP670_1152 | 1071643..1071771 | + | 129 | ADM91215 | hypothetical protein | - |
| SP670_1153 | 1071807..1072010 | - | 204 | ADM91216 | conserved domain protein | - |
| SP670_1154 | 1072698..1073120 | - | 423 | ADM91217 | sigma-70, region 4 family | - |
| SP670_1155 | 1073153..1073269 | + | 117 | ADM91218 | hypothetical protein | - |
| SP670_1156 | 1073625..1073978 | + | 354 | ADM91219 | transcriptional regulator, putative | - |
| SP670_1157 | 1074324..1076243 | - | 1920 | ADM91220 | TetM protein | - |
| SP670_1158 | 1076620..1077537 | - | 918 | ADM91221 | conjugative transposon protein | orf13 |
| SP670_1159 | 1077552..1078553 | - | 1002 | ADM91222 | NLP/P60 family protein | orf14 |
| SP670_1160 | 1078550..1080661 | - | 2112 | ADM91223 | conjugative transposon membrane protein | orf15 |
| SP670_1161 | 1080730..1083177 | - | 2448 | ADM91224 | conjugative transposon protein | virb4 |
| SP670_1162 | 1083161..1083391 | - | 231 | ADM91225 | conjugative transposon membrane protein | orf17a |
| SP670_1163 | 1083642..1084139 | - | 498 | ADM91226 | conjugative transposon protein | - |
| SP670_1164 | 1084256..1084477 | - | 222 | ADM91227 | conserved domain protein | orf19 |
| SP670_1165 | 1084657..1085904 | + | 1248 | ADM91228 | transposase | - |
| SP670_1166 | 1086161..1086898 | - | 738 | ADM91229 | rRNA adenine N-6-methyltransferase | - |
| SP670_1167 | 1087155..1088573 | - | 1419 | ADM91230 | transcriptional regulator, Cro/CI family | - |
| SP670_1168 | 1088751..1090136 | - | 1386 | ADM91231 | ftsk/spoiiie family protein | virb4 |
| SP670_1169 | 1090165..1090548 | - | 384 | ADM91232 | conjugative transposon protein | orf23 |
| SP670_1170 | 1090567..1090881 | - | 315 | ADM91233 | conjugative transposon protein | orf23 |
| SP670_1171 | 1091197..1091703 | - | 507 | ADM91234 | Zn-dependent protease of MPP family, putative | - |
| SP670_1172 | 1091696..1092817 | - | 1122 | ADM91235 | ThiF family protein | - |
| SP670_1173 | 1092976..1093089 | - | 114 | ADM91236 | hypothetical protein | - |
| SP670_1174 | 1093079..1094662 | - | 1584 | ADM91237 | ABC-type multidrug/protein/lipid transport system | - |
| SP670_1175 | 1095054..1095350 | - | 297 | ADM91238 | conserved hypothetical protein | gbs1350 |
| SP670_1176 | 1095364..1095648 | - | 285 | ADM91239 | conserved hypothetical protein | - |
| SP670_1177 | 1095723..1101947 | - | 6225 | ADM91240 | SNF2 family protein | - |
| SP670_1178 | 1101995..1102405 | - | 411 | ADM91241 | OmpA domain protein | cd424 |
| SP670_1179 | 1102549..1102812 | + | 264 | ADM91242 | hypothetical protein | - |
| SP670_1180 | 1102868..1103032 | + | 165 | ADM91243 | hypothetical protein | - |
| SP670_1181 | 1103034..1103642 | + | 609 | ADM91244 | conserved hypothetical protein | - |
| SP670_1182 | 1103677..1106490 | - | 2814 | ADM91245 | conserved hypothetical protein | prgK |
| SP670_1183 | 1106502..1108817 | - | 2316 | ADM91246 | conserved hypothetical protein | virb4 |
| SP670_1184 | 1108810..1109169 | - | 360 | ADM91247 | conserved hypothetical protein | prgIc |
| SP670_1185 | 1109223..1110077 | - | 855 | ADM91248 | membrane protein, putative | prgHb |
| SP670_1186 | 1110094..1110336 | - | 243 | ADM91249 | conserved hypothetical protein | prgF |
| SP670_1187 | 1110357..1112234 | - | 1878 | ADM91250 | TraG/TraD family protein | virb4 |
| SP670_1188 | 1112234..1112722 | - | 489 | ADM91251 | conserved hypothetical protein | gbs1365 |
| SP670_1189 | 1112712..1113011 | - | 300 | ADM91252 | conserved hypothetical protein | - |
| SP670_1190 | 1113293..1114129 | - | 837 | ADM91253 | abortive infection protein AbiGII, putative | - |
| SP670_1191 | 1114129..1114719 | - | 591 | ADM91254 | conserved hypothetical protein | - |
| SP670_1192 | 1114847..1115089 | - | 243 | ADM91255 | caax amino protease family | - |
| SP670_1193 | 1115144..1115779 | - | 636 | ADM91256 | hypothetical protein | - |
| SP670_1194 | 1116071..1116658 | - | 588 | ADM91257 | caax amino protease family | - |
| SP670_1195 | 1116661..1116894 | - | 234 | ADM91258 | conserved hypothetical protein | - |
| SP670_1196 | 1116907..1117287 | - | 381 | ADM91259 | conserved hypothetical protein | - |
| SP670_1197 | 1117280..1117729 | - | 450 | ADM91260 | conserved hypothetical protein | gbs1369 |
| SP670_1198 | 1117713..1118462 | - | 750 | ADM91261 | methyl transferase | - |
| SP670_1199 | 1118498..1119007 | - | 510 | ADM91262 | methyl transferase | - |
| SP670_1200 | 1119170..1119949 | - | 780 | ADM91263 | replication initiator A domain protein | - |
| SP670_1201 | 1119946..1120119 | - | 174 | ADM91264 | conserved hypothetical protein | - |
Host bacterium
| ID | 415 | Element type | ICE (Integrative and conjugative element) |
| Element name | ICESpn6706B-1 | GenBank | CP002176 |
| Element size | 2240045 bp | Coordinate of oriT [Strand] | 49102..49234 [-] |
| Host bacterium | Streptococcus pneumoniae 670-6B | Coordinate of element | 1039483..1120356 |
Cargo genes
| Drug resistance gene | cat(pC194), tet(M), erm(B) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIB, AcrIIA21 |