Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 200470
• Name: oriT_ICESpn6706B-1
• Organism: Streptococcus pneumoniae 670-6B
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): CP002176 (49102..49234 [-], 133 nt)
• oriT length: 133 nt
• IRs (inverted repeats): 65..70, 83..88 (AAATCC..GGATTT) 4..11, 23..30 (TACCCCCC..GGGGGGTA) 7..12, 23..28 (CCCCCC..GGGGGG)
• Location of nic site: 75..76
• Conserved sequence flanking the nic site: TTTGGTTACA
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 133 nt

>oriT_ICESpn6706B-1
ACTTACCCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATAC

oriT secondary structure

Predicted by RNAfold.

Relaxase

Rep_trans_SP670_1167_ICESpn6706B-1

• ID: 14499
• GenBank: ADM91230
• Name: Rep_trans_SP670_1167_ICESpn6706B-1
• UniProt ID: _
• Length: 472 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 472 a.a.
• Molecular weight: 55639.89 Da
• Isoelectric Point: 8.3884

>ADM91230.1 transcriptional regulator, Cro/CI family [Streptococcus pneumoniae 670-6B]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKKGYLSTIPVDRYPKKDIMGD
KTVRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVHYLKILYNRN

Protein domains

Predicted by InterproScan.

• Replication initiation factor (Rep_trans) (169-373)

• Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N) (73-161)

• Helix-turn-helix (HTH_3) (15-53)

• Omega Transcriptional Repressor (Omega_Repress) (414-453)

Protein structure

No available structure.

Auxiliary protein

ADM91214_ICESpn6706B-1

• ID: 7917
• GenBank: ADM91214
• Name: ADM91214_ICESpn6706B-1
• UniProt ID: _
• Length: 361 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Auxiliary protein sequence

• Length: 361 a.a.
• Molecular weight: 41653.86 Da
• Isoelectric Point: 9.5342

>ADM91214.1 integrase [Streptococcus pneumoniae 670-6B]
MATDLVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILK
KDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDD
TVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDT
EIGYYIETPKTKSGERQVPMVEEAYQAFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKG
LVKKYNKYNEDKLPHITPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRL
NKEKQQERLVA

Protein domains

Predicted by InterproScan.

• Phage integrase family (Phage_integrase) (146-339)

Protein structure

No available structure.

T4CP

tcpA_SP670_1168_ICESpn6706B-1

• ID: 17107
• GenBank: ADM91231
• Name: tcpA_SP670_1168_ICESpn6706B-1
• UniProt ID: _
• Length: 461 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

T4CP protein sequence

• Length: 461 a.a.
• Molecular weight: 53370.27 Da
• Isoelectric Point: 9.0687

>ADM91231.1 ftsk/spoiiie family protein [Streptococcus pneumoniae 670-6B]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

Protein domains

Predicted by InterproScan.

• FtsK/SpoIIIE family (FtsK_SpoIIIE) (217-301)

Protein structure

No available structure.

t4cp2_SP670_1187_ICESpn6706B-1

• ID: 17108
• GenBank: ADM91250
• Name: t4cp2_SP670_1187_ICESpn6706B-1
• UniProt ID: _
• Length: 625 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

T4CP protein sequence

• Length: 625 a.a.
• Molecular weight: 72493.87 Da
• Isoelectric Point: 9.6098

>ADM91250.1 TraG/TraD family protein [Streptococcus pneumoniae 670-6B]
MYSGKKFLLFSLLGILLGYLFHRLTLLYDSYTGNTLDKWTHLLMEGQDEVLQSPWNVSFTGKSSAFFLLG
FVMMLLVYLYLETGKKQYREGVEYGSARFGTLKEKKLFYGKEFSHDTILAQDVRLTLLDKKPPQYDRNKN
IAVIGGSGSGKTFRFVKPNLIQMNSSNIVVDPKDHLAEKTGKLFLERGYQVKVLDLVNMKNSDGFNPFRY
IETENDLNRMLTVYFNNTKGSGSRSDPFWDEASMTLVRALASYLVDFYNPPKTREQLIEESRLSQKEYQN
LLKRQKKEVEERKKRGRYPSFAEISKLIKHLSKGENQEKSVLEILFENYAKKYGTENFTMRNWADFQNYK
DKTLDSVIAVTTAKFALFNIQSVMDLTKRDTLDMKTWGQEKSMVYLVIPDNDSTFRFLSALFFSTVFQTL
TRQADIDFKGQLPLHVRVYLDEFANIGEIPDFAEQTSTVRSRNMSLVPILQNIAQLQGLYKEKEAWKTIL
GNCDSLVYLGGNDEDTFKFMSGLLGKQTIDVRNTSRSFGQTGSGSLSHQKIARDLMTPDEIGNMKRHECL
VRIANMPVFKSKKYYSTKHPNWKYLANQETDERWWNYQINPLNQRQENHLEGLRIRDLTFESSLK

Protein domains

Predicted by InterproScan.

• Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf) (131-576)

Protein structure

No available structure.

T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1055866..1117729

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
SP670_1126	1051263..1052513	-	1251	ADM91189	conserved hypothetical protein	-
SP670_1127	1052607..1053503	+	897	ADM91190	tyrosine recombinase	-
SP670_1128	1053880..1054260	-	381	ADM91191	zeta toxin superfamily	-
SP670_1129	1054321..1054500	+	180	ADM91192	conserved domain protein	-
SP670_1130	1054621..1054848	-	228	ADM91193	hypothetical protein	-
SP670_1131	1054839..1055471	-	633	ADM91194	hypothetical protein	-
SP670_1132	1055553..1055828	-	276	ADM91195	conserved hypothetical protein	-
SP670_1133	1055866..1056249	-	384	ADM91196	conserved hypothetical protein	gbs1346
SP670_1134	1056246..1056479	-	234	ADM91197	conserved hypothetical protein	gbs1347
SP670_1135	1056530..1057615	-	1086	ADM91198	conserved hypothetical protein	traP
SP670_1136	1057625..1058266	-	642	ADM91199	conserved hypothetical protein	prgL
SP670_1137	1058594..1058968	-	375	ADM91200	choline transport ATP-binding protein opuBA	-
SP670_1138	1059308..1060153	+	846	ADM91201	replication protein	-
SP670_1139	1061018..1061668	-	651	ADM91202	chloramphenicol O-acetyltransferase	-
SP670_1140	1061839..1062087	-	249	ADM91203	hypothetical protein	-
SP670_1141	1062335..1063141	-	807	ADM91204	hypothetical protein	-
SP670_1142	1063602..1064372	-	771	ADM91205	zeta toxin	-
SP670_1143	1064372..1064848	-	477	ADM91206	helix-turn-helix domain protein	-
SP670_1144	1064919..1065191	-	273	ADM91207	conserved hypothetical protein	-
SP670_1145	1065229..1065612	-	384	ADM91208	conserved hypothetical protein	gbs1346
SP670_1146	1065609..1065842	-	234	ADM91209	conserved hypothetical protein	gbs1347
SP670_1147	1065893..1066978	-	1086	ADM91210	PcfD	traP
SP670_1148	1066988..1067629	-	642	ADM91211	conserved hypothetical protein	prgL
SP670_1149	1068804..1069688	+	885	ADM91212	positive transcriptional regulator MutR family	-
SP670_1150	1069651..1070331	-	681	ADM91213	hypothetical protein	-
SP670_1151	1070508..1071593	-	1086	ADM91214	integrase	-
SP670_1152	1071643..1071771	+	129	ADM91215	hypothetical protein	-
SP670_1153	1071807..1072010	-	204	ADM91216	conserved domain protein	-
SP670_1154	1072698..1073120	-	423	ADM91217	sigma-70, region 4 family	-
SP670_1155	1073153..1073269	+	117	ADM91218	hypothetical protein	-
SP670_1156	1073625..1073978	+	354	ADM91219	transcriptional regulator, putative	-
SP670_1157	1074324..1076243	-	1920	ADM91220	TetM protein	-
SP670_1158	1076620..1077537	-	918	ADM91221	conjugative transposon protein	orf13
SP670_1159	1077552..1078553	-	1002	ADM91222	NLP/P60 family protein	orf14
SP670_1160	1078550..1080661	-	2112	ADM91223	conjugative transposon membrane protein	orf15
SP670_1161	1080730..1083177	-	2448	ADM91224	conjugative transposon protein	virb4
SP670_1162	1083161..1083391	-	231	ADM91225	conjugative transposon membrane protein	orf17a
SP670_1163	1083642..1084139	-	498	ADM91226	conjugative transposon protein	-
SP670_1164	1084256..1084477	-	222	ADM91227	conserved domain protein	orf19
SP670_1165	1084657..1085904	+	1248	ADM91228	transposase	-
SP670_1166	1086161..1086898	-	738	ADM91229	rRNA adenine N-6-methyltransferase	-
SP670_1167	1087155..1088573	-	1419	ADM91230	transcriptional regulator, Cro/CI family	-
SP670_1168	1088751..1090136	-	1386	ADM91231	ftsk/spoiiie family protein	virb4
SP670_1169	1090165..1090548	-	384	ADM91232	conjugative transposon protein	orf23
SP670_1170	1090567..1090881	-	315	ADM91233	conjugative transposon protein	orf23
SP670_1171	1091197..1091703	-	507	ADM91234	Zn-dependent protease of MPP family, putative	-
SP670_1172	1091696..1092817	-	1122	ADM91235	ThiF family protein	-
SP670_1173	1092976..1093089	-	114	ADM91236	hypothetical protein	-
SP670_1174	1093079..1094662	-	1584	ADM91237	ABC-type multidrug/protein/lipid transport system	-
SP670_1175	1095054..1095350	-	297	ADM91238	conserved hypothetical protein	gbs1350
SP670_1176	1095364..1095648	-	285	ADM91239	conserved hypothetical protein	-
SP670_1177	1095723..1101947	-	6225	ADM91240	SNF2 family protein	-
SP670_1178	1101995..1102405	-	411	ADM91241	OmpA domain protein	cd424
SP670_1179	1102549..1102812	+	264	ADM91242	hypothetical protein	-
SP670_1180	1102868..1103032	+	165	ADM91243	hypothetical protein	-
SP670_1181	1103034..1103642	+	609	ADM91244	conserved hypothetical protein	-
SP670_1182	1103677..1106490	-	2814	ADM91245	conserved hypothetical protein	prgK
SP670_1183	1106502..1108817	-	2316	ADM91246	conserved hypothetical protein	virb4
SP670_1184	1108810..1109169	-	360	ADM91247	conserved hypothetical protein	prgIc
SP670_1185	1109223..1110077	-	855	ADM91248	membrane protein, putative	prgHb
SP670_1186	1110094..1110336	-	243	ADM91249	conserved hypothetical protein	prgF
SP670_1187	1110357..1112234	-	1878	ADM91250	TraG/TraD family protein	virb4
SP670_1188	1112234..1112722	-	489	ADM91251	conserved hypothetical protein	gbs1365
SP670_1189	1112712..1113011	-	300	ADM91252	conserved hypothetical protein	-
SP670_1190	1113293..1114129	-	837	ADM91253	abortive infection protein AbiGII, putative	-
SP670_1191	1114129..1114719	-	591	ADM91254	conserved hypothetical protein	-
SP670_1192	1114847..1115089	-	243	ADM91255	caax amino protease family	-
SP670_1193	1115144..1115779	-	636	ADM91256	hypothetical protein	-
SP670_1194	1116071..1116658	-	588	ADM91257	caax amino protease family	-
SP670_1195	1116661..1116894	-	234	ADM91258	conserved hypothetical protein	-
SP670_1196	1116907..1117287	-	381	ADM91259	conserved hypothetical protein	-
SP670_1197	1117280..1117729	-	450	ADM91260	conserved hypothetical protein	gbs1369
SP670_1198	1117713..1118462	-	750	ADM91261	methyl transferase	-
SP670_1199	1118498..1119007	-	510	ADM91262	methyl transferase	-
SP670_1200	1119170..1119949	-	780	ADM91263	replication initiator A domain protein	-
SP670_1201	1119946..1120119	-	174	ADM91264	conserved hypothetical protein	-

Host bacterium

• ID: 415
• Element type: ICE (Integrative and conjugative element)
• Element name: ICESpn6706B-1
• GenBank: CP002176
• Element size: 2240045 bp
• Coordinate of oriT [Strand]: 49102..49234 [-]
• Host bacterium: Streptococcus pneumoniae 670-6B
• Coordinate of element: 1039483..1120356

Cargo genes

• Drug resistance gene: cat(pC194), tet(M), erm(B)
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: AcrIB, AcrIIA21