Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 200466
• Name: oriT_Tn1311
• Organism: Streptococcus pneumoniae
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): FN667862 (43312..43444 [-], 133 nt)
• oriT length: 133 nt
• IRs (inverted repeats): 65..70, 83..88 (AAATCC..GGATTT) 6..12, 23..29 (ACCCCCC..GGGGGGT)
• Location of nic site: 75..76
• Conserved sequence flanking the nic site: TTTGGTTACA
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 133 nt

>oriT_Tn1311
ACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATAC

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_-_Tn1311

• ID: 14490
• GenBank: CBJ57175
• Name: Relaxase_-_Tn1311
• UniProt ID: _
• Length: 530 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 530 a.a.
• Molecular weight: 63859.89 Da
• Isoelectric Point: 8.6052

>CBJ57175.1 putative relaxase [Streptococcus pneumoniae]
MHAHHIIQSFSPDDHLTPEQINRIGYETAKELTGGRFRFIVATHVDKDHIHNHIILNSIDKNSDKKFLWD
YKAERNLRMVSDRLSKIVGAKIIENRYSHHQYEVYRKTNYKYEIKQRVYFLIENSKNFEDFKKKAKDLHL
KIDFRHKHVTFFMTDSNMKQVVRDNKLNRKQPYNETYFKKKFVQREIINILEFLLPKMKNMNELIQQAEF
FGLKIILKAKHVLFEFDGIKFSEQELVKSNQYSVSYFQDYFNNKNDTFGLDNKNLVELYNEEKLIKEKKL
PTEDMVWKSYQDFKRNRDAVHEFEVELNLNQIEEVVDDGIYIKVQFGIRQEGLIFVPNIQINMEEEKVKV
FLRETSSYYVYHKDLAEKNRFMKGKTLIRQFNLQYEQQYMYRRISLSKIKEKIEQLDFLMSAENSPNDFE
DITNDFIAQISYLENMIEQVQNKIDDLTNLEEVLLNNTTNSSSNLENSIQDKSSVDKIEKDLYIYKGKIE
KLKEQHREAINLFEMFNKTIKKYKKKQNMKSIEENEIHLE

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (2-185)

Protein structure

No available structure.

Rep_trans_-_Tn1311

• ID: 14491
• GenBank: CBJ57220
• Name: Rep_trans_-_Tn1311
• UniProt ID: _
• Length: 429 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 429 a.a.
• Molecular weight: 50804.48 Da
• Isoelectric Point: 8.8724

>CBJ57220.1 hypothetical protein [Streptococcus pneumoniae]
MLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGC
RQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGE
LVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVY
DNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAP
TLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKKGYLSTIPVDRYPKKDIMGDKT
VRVRADLHHIIKIETAKNGGNVKEVMEIRLRSKLKSVLIVHYLKILYNRSGFKIGSVDTMLYANFENNFE
KAVFWYLRF

Protein domains

Predicted by InterproScan.

• Omega Transcriptional Repressor (Omega_Repress) (342-381)

• Replication initiation factor (Rep_trans) (97-301)

• Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N) (2-89)

Protein structure

No available structure.

Auxiliary protein

CBJ57206_Tn1311

• ID: 7913
• GenBank: CBJ57206
• Name: CBJ57206_Tn1311
• UniProt ID: _
• Length: 405 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

Auxiliary protein sequence

• Length: 405 a.a.
• Molecular weight: 47021.92 Da
• Isoelectric Point: 9.7978

>CBJ57206.1 integrase [Streptococcus pneumoniae]
MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKD
IHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSE
NGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYS
KNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQ
AFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFC
TNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA

Protein domains

Predicted by InterproScan.

• Phage integrase family (Phage_integrase) (190-383)

• DNA binding domain of tn916 integrase (Integrase_DNA) (1-71)

Protein structure

No available structure.

T4CP

tcpA_-_Tn1311

• ID: 17098
• GenBank: CBJ57221
• Name: tcpA_-_Tn1311
• UniProt ID: _
• Length: 454 a.a.
• PDB ID: _
• Note: Predicted by oriTfinder 2.0

T4CP protein sequence

• Length: 454 a.a.
• Molecular weight: 52503.21 Da
• Isoelectric Point: 8.4588

>CBJ57221.1 hypothetical protein [Streptococcus pneumoniae]
MRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAILICLLVAF
VFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGLIQIRV
EITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWE
YDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFY
EEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFL
ILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSVISEFYTP
LVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

Protein domains

Predicted by InterproScan.

• FtsK/SpoIIIE family (FtsK_SpoIIIE) (210-294)

Protein structure

No available structure.

T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 16558..28154

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
Locus_10	11810..13060	-	1251	CBJ57182	hypothetical protein	-
Locus_11	13154..14050	+	897	CBJ57183	hypothetical protein	-
Locus_12	14427..14798	-	372	CBJ57184	hypothetical protein	-
Locus_13	15313..15540	-	228	CBJ57185	hypothetical protein	-
Locus_14	15531..16166	-	636	CBJ57186	hypothetical protein	-
Locus_15	16245..16520	-	276	CBJ57187	hypothetical protein	-
Locus_16	16558..16941	-	384	CBJ57188	hypothetical protein	gbs1346
Locus_17	16938..17171	-	234	CBJ57189	hypothetical protein	gbs1347
Locus_18	17222..18307	-	1086	CBJ57190	hypothetical protein	traP
Locus_19	18317..18958	-	642	CBJ57191	hypothetical protein	prgL
Locus_20	19910..20845	+	936	CBJ57192	replication protein	-
Locus_21	21710..22360	-	651	CBJ57193	chloramphenicol acetyltransferase	-
Locus_22	22532..22780	-	249	CBJ57194	hypothetical protein	-
Locus_23	23028..23834	-	807	CBJ57195	hypothetical protein	-
Locus_24	24295..25065	-	771	CBJ57196	hypothetical protein	-
Locus_25	25065..25541	-	477	CBJ57197	putative transcriptional regulator	-
Locus_26	25612..25884	-	273	CBJ57198	hypothetical protein	-
Locus_27	25922..26305	-	384	CBJ57199	hypothetical protein	gbs1346
Locus_28	26302..26535	-	234	CBJ57200	hypothetical protein	gbs1347
Locus_29	27132..27668	-	537	CBJ57201	hypothetical protein	traP
Locus_30	27678..28154	-	477	CBJ57202	hypothetical protein	prgL
Locus_31	29073..29261	+	189	CBJ57203	hypothetical protein	-
Locus_32	29540..30436	+	897	CBJ57204	hypothetical protein	-
Locus_33	30399..31079	-	681	CBJ57205	hypothetical protein	-
Locus_34	31256..32473	-	1218	CBJ57206	integrase	-
Locus_35	32555..32758	-	204	CBJ57207	excisionase	-
Locus_36	32742..32993	+	252	CBJ57208	hypothetical protein	-

Region 2: 43479..72347

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
Locus_44	38499..39236	-	738	CBJ57216	erythromycin ribosome methylase	-
Locus_45	39361..39444	-	84	CBJ57217	MLS leader peptide	-
Locus_46	40125..40634	-	510	CBJ57218	hypothetical protein	-
Locus_47	40910..41704	-	795	CBJ57219	aminoglycoside phosphotransferase type III	-
Locus_48	41797..43086	-	1290	CBJ57220	hypothetical protein	-
Locus_49	43479..44843	-	1365	CBJ57221	hypothetical protein	virb4
Locus_50	44892..45278	-	387	CBJ57222	hypothetical protein	orf23
Locus_51	45294..45608	-	315	CBJ57223	hypothetical protein	orf23
Locus_52	45631..45750	-	120	CBJ57224	hypothetical protein	-
Locus_53	45924..46430	-	507	CBJ57225	hypothetical protein	-
Locus_54	46605..47543	-	939	CBJ57226	hypothetical protein	-
Locus_55	47805..48950	-	1146	CBJ57227	hypothetical protein	-
Locus_56	49781..50077	-	297	CBJ57228	hypothetical protein	gbs1350
Locus_57	50091..50375	-	285	CBJ57229	hypothetical protein	-
Locus_58	50450..51835	-	1386	CBJ57230	hypothetical protein	-
Locus_59	51829..54162	-	2334	CBJ57231	hypothetical protein	-
Locus_60	54134..55717	-	1584	CBJ57232	hypothetical protein	-
Locus_61	55672..56181	-	510	CBJ57233	hypothetical protein	-
Locus_62	56342..56686	-	345	CBJ57234	hypothetical protein	-
Locus_63	56719..57129	-	411	CBJ57235	hypothetical protein	cd424
Locus_64	57757..58365	+	609	CBJ57236	hypothetical protein	-
Locus_65	58400..59863	-	1464	CBJ57237	putative conjugal transfer protein	prgK
Locus_66	59812..60543	-	732	CBJ57238	putative conjugal transfer protein	prgK
Locus_67	60527..61108	-	582	CBJ57239	putative conjugal transfer protein	prgK
Locus_68	61120..63477	-	2358	CBJ57240	putative conjugal transfer protein	virb4
Locus_69	63841..64695	-	855	CBJ57241	hypothetical protein	prgHb
Locus_70	66852..67340	-	489	CBJ57242	putative conjugal transfer protein TraG	gbs1365
Locus_71	67330..67629	-	300	CBY05915	hypothetical protein	-
Locus_72	67911..68747	-	837	CBY05916	hypothetical protein	-
Locus_73	68747..69391	-	645	CBY05917	hypothetical protein	-
Locus_74	69465..69707	-	243	CBY05918	putative caax amino protease family protein	-
Locus_75	69762..70397	-	636	CBY05919	hypothetical protein	-
Locus_76	70689..71276	-	588	CBY05920	putative caax amino protease family protein	-
Locus_77	71279..71512	-	234	CBY05921	hypothetical protein	-
Locus_78	71525..71905	-	381	CBY05922	hypothetical protein	-
Locus_79	71898..72347	-	450	CBY05923	hypothetical protein	gbs1369
Locus_80	72331..73689	-	1359	CBY05924	putative DNA methylase	-
Locus_81	73788..74201	-	414	CBY05925	hypothetical protein	-
Locus_82	74303..74569	-	267	CBY05926	putative replication initiator protein A	-

Host bacterium

• ID: 411
• Element type: ICE (Integrative and conjugative element)
• Element name: Tn1311
• GenBank: FN667862
• Element size: 75303 bp
• Coordinate of oriT [Strand]: 43312..43444 [-]
• Host bacterium: Streptococcus pneumoniae
• Coordinate of element: 1..75303

Cargo genes

• Drug resistance gene: cat(pC194), erm(B), aph(3')-III
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: AcrIB, AcrIIA21