Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200461
Name   oriT2_ICESgal1 in_silico
Organism   Streptococcus gallolyticus UCN34
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   FN597254 ( 32255..32292 [-], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      14..22, 29..37  (TAAAGTATA..TATACTTTA)
 2..8, 13..19  (ACTTTAT..ATAAAGT)
Location of nic site      27..28
Conserved sequence flanking the
  nic site    		  GTGTGTTATA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 38 nt

>oriT2_ICESgal1
CACTTTATGAATATAAAGTATAGTGTGTTATACTTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14482 GenBank   CBI14187
Name   Rep_trans_GALLO_1696_ICESgal1 insolico UniProt ID   _
Length   401 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47398.10 Da        Isoelectric Point: 6.5091

>CBI14187.1 putative transcriptional regulator, Cro/CI family (Tn916) [Streptococcus gallolyticus UCN34]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(15-53)

Replication initiation factor (Rep_trans)

(169-373)

Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N)

(73-161)


  Protein structure



No available structure.




Auxiliary protein

ID   7908 GenBank   CBI14167
Name   CBI14167_ICESgal1 insolico UniProt ID   _
Length   405 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 405 a.a.        Molecular weight: 47021.92 Da        Isoelectric Point: 9.7978

>CBI14167.1 putative integrase [Streptococcus gallolyticus UCN34]
MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKD
IHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSE
NGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYS
KNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQ
AFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFC
TNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA

  Protein domains


Predicted by InterproScan.

Phage integrase family (Phage_integrase)

(190-383)

DNA binding domain of tn916 integrase (Integrase_DNA)

(1-71)


  Protein structure



No available structure.




T4CP

ID   17088 GenBank   CBI14163
Name   tcpA_GALLO_1672_ICESgal1 insolico UniProt ID   _
Length   569 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 569 a.a.        Molecular weight: 65680.56 Da        Isoelectric Point: 7.3661

>CBI14163.1 putative DNA segregation ATPase, FtsK/SpoIIIE family [Streptococcus gallolyticus UCN34]
MRLLPEYRGRRIRPYMRKLNVTLAFVFSFVLLLPSIAFGYVNIDALKAVDVKTIVILAVLSVLAIVLGIW
FSWFFREQTPFGKKVDRLGILSKYFFEHGFYYEKKRSGQNVKSKIRYPKIYVKQRKYDLDISFEMAGNKF
QDKFSKMGGELEKTLFMDFMETVDDVKYKTYTMAYQAFLNRINVTDVTYEKGKGLLLMKNFYWDFDSDPH
LLVAGGTGGGKTVLLQTLVLALAKIGVVDICDPKQADFVAIADMPAFKGRVAFDVEDIIQRFEKAEVIMM
ARYKFMNDERVRLKHKSLKKYYEYGLEPYFISCDELNALMAMLDYKQRERLDKSLGNILFLGRQAGVFDI
SAMQKPSREDLGSKLQANINMRLNVGRLDDGGYDIMYGEVNRNKDFKYLKYISGRRVYGRGYGAVMGDVA
REFFSPNMPKGFEFYDEFIKLERHENRFDPDENPEISVDIVNDKELLAVATEATNQANQISANKVQTEET
KYSLKEVADSIGASRPQVFKVVKMIEDDGYTTFEHDDTDKQVLTSSEVALVKELFDFKATNDLTWSNAVE
QYFTKESED

  Protein domains


Predicted by InterproScan.

FtsK/SpoIIIE family (FtsK_SpoIIIE)

(200-315)

  Protein structure



No available structure.



ID   17089 GenBank   CBI14188
Name   tcpA_GALLO_1697_ICESgal1 insolico UniProt ID   _
Length   461 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53370.27 Da        Isoelectric Point: 9.0687

>CBI14188.1 Tn916 conserved hypothetical protein, putative translocase [Streptococcus gallolyticus UCN34]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

FtsK/SpoIIIE family (FtsK_SpoIIIE)

(217-301)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1740511..1761877

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GALLO_1646 1738037..1739167 - 1131 CBI14137 putative integrase -
GALLO_1647 1739222..1739452 - 231 CBI14138 putative excisionase -
GALLO_1648 1739766..1740476 + 711 CBI14139 conserved hypothetical protein -
GALLO_1649 1740511..1741413 - 903 CBI14140 Putative peptidoglycan linked serine rich protein (LPXTG motif) prgC
GALLO_1650 1741431..1741997 - 567 CBI14141 conserved hypothetical secreted protein -
GALLO_1651 1742008..1742706 - 699 CBI14142 putative sortase, A-type family -
GALLO_1652 1742722..1744116 - 1395 CBI14143 conserved hypothetical secreted protein -
GALLO_1653 1744118..1746262 - 2145 CBI14144 conserved hypothetical membrane protein -
GALLO_1654 1746272..1748773 - 2502 CBI14145 putative conjugative transposon protein virb4
GALLO_1655 1748915..1749445 + 531 CBI14146 hypothetical protein -
GALLO_1656 1749431..1749697 - 267 CBI14147 hypothetical protein -
GALLO_1657 1749757..1750167 - 411 CBI14148 conserved hypothetical protein orf17b
GALLO_1658 1750171..1750437 - 267 CBI14149 conserved hypothetical protein -
GALLO_1659 1750473..1751447 - 975 CBI14150 conserved hypothetical secreted protein orf13
GALLO_1660 1751466..1751900 - 435 CBI14151 conserved hypothetical protein -
GALLO_1661 1751917..1752285 - 369 CBI14152 hypothetical protein -
GALLO_1662 1752285..1752500 - 216 CBI14153 hypothetical protein -
GALLO_1663 1752511..1752993 - 483 CBI14154 conserved hypothetical protein -
GALLO_1664 1753012..1753512 - 501 CBI14155 hypothetical protein -
GALLO_1665 1753563..1753835 - 273 CBI14156 conserved hypothetical protein -
GALLO_1666 1754053..1754463 - 411 CBI14157 putative transcriptional regulator -
GALLO_1667 1754526..1754720 - 195 CBI14158 hypothetical protein -
GALLO_1668 1754804..1755202 - 399 CBI14159 conserved hypothetical protein -
GALLO_1669 1755217..1755480 - 264 CBI14160 hypothetical protein -
GALLO_1670 1755507..1756757 - 1251 CBI14161 putative transcriptional regulator, Cro/CI family -
GALLO_1671 1756783..1756992 - 210 CBI14162 Hypothetical protein -
GALLO_1672 1757031..1758740 - 1710 CBI14163 putative DNA segregation ATPase, FtsK/SpoIIIE family virb4
GALLO_1673 1758751..1759218 - 468 CBI14164 conserved hypothetical protein -
GALLO_1674 1759218..1759529 - 312 CBI14165 conserved hypothetical protein -
GALLO_1675 1759598..1761877 - 2280 CBI14166 Putative peptidoglycan linked protein (LPXTG motif) prgB
GALLO_1676 1762086..1763303 - 1218 CBI14167 putative integrase -
GALLO_1677 1763385..1763588 - 204 CBI14168 Tn916 conserved hypothetical protein, putative excisionase -
GALLO_1678 1763572..1763823 + 252 CBI14169 Tn916 hypothetical protein -
GALLO_1679 1764049..1764279 - 231 CBI14170 Tn916 conserved hypothetical protein -
GALLO_1680 1764276..1764698 - 423 CBI14171 Tn916 conserved hypothetical protein -
GALLO_1681 1765203..1765556 + 354 CBI14172 putative transcriptional regulator (Tn916) -
GALLO_1682 1765616..1765804 - 189 CBI14173 Tn916 conserved hypothetical protein -

Region 2: 1774651..1786061

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GALLO_1686 1770785..1772161 - 1377 CBI14177 tetracycline resistance protein -
GALLO_1687 1772355..1774274 - 1920 CBI14178 tetracycline resistence protein TetM -
GALLO_1688 1774290..1774376 - 87 CBI14179 TetM leader peptide -
GALLO_1689 1774651..1775583 - 933 CBI14180 Tn916 conserved hypothetical protein orf13
GALLO_1690 1775580..1776581 - 1002 CBI14181 Tn916 conserved hypothetical protein orf14
GALLO_1691 1776578..1778755 - 2178 CBI14182 Tn916 conserved hypothetical protein orf15
GALLO_1692 1778758..1781205 - 2448 CBI14183 Tn916 conserved hypothetical protein virb4
GALLO_1693 1781189..1781581 - 393 CBI14184 Tn916 conserved hypothetical protein orf17a
GALLO_1694 1781670..1782167 - 498 CBI14185 Tn916 conserved hypothetical protein -
GALLO_1695 1782284..1782505 - 222 CBI14186 Tn916 conserved hypothetical protein orf19
GALLO_1696 1782548..1783753 - 1206 CBI14187 putative transcriptional regulator, Cro/CI family (Tn916) -
GALLO_1697 1783931..1785316 - 1386 CBI14188 Tn916 conserved hypothetical protein, putative translocase virb4
GALLO_1698 1785345..1785728 - 384 CBI14189 Tn916 conserved hypothetical protein orf23
GALLO_1699 1785747..1786061 - 315 CBI14190 Tn916 conserved hypothetical protein orf23
GALLO_1700 1786084..1786203 - 120 CBI14191 Tn916 conserved hypothetical protein -
GALLO_1701 1786497..1786814 - 318 CBI14192 conserved hypothetical protein -
GALLO_1702 1786831..1787268 - 438 CBI14193 conserved hypothetical protein -
GALLO_1703 1787265..1787519 - 255 CBI14194 conserved hypothetical protein -
GALLO_1704 1787572..1787832 - 261 CBI14195 conserved hypothetical protein -
GALLO_1705 1788021..1788431 - 411 CBI14196 conserved hypothetical protein -
GALLO_1706 1788367..1788717 - 351 CBI14197 conserved hypothetical protein -
GALLO_1707 1789020..1789607 - 588 CBI14198 conserved hypothetical protein -
GALLO_1708 1790579..1790932 + 354 CBI14199 putative transcriptional regulator, Cro/CI family -

Host bacterium

ID   407 Element type   ICE (Integrative and conjugative element)
Element name   ICESgal1 GenBank   FN597254
Element size   2350911 bp Coordinate of oriT [Strand]   45728..45860 [-]; 32255..32292 [-]
Host bacterium   Streptococcus gallolyticus UCN34 Coordinate of element   1738037..1787519

Cargo genes

Drug resistance gene   tet(L), tet(M)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -