Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200451
Name   oriT_ICE-GI6 in_silico
Organism   Bordetella petrii strain DSM 12804
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   AM902716 (_)
oriT length   468 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 468 nt

>oriT_ICE-GI6
GAGGCCGGGAAGGCCTGGACCAGCTCGGCGTAGCGTTCCAGGGGCGTGCGGTACAGGGTGGCGAATTGCCTGCGCGAGAGCGAGGTTCGCTGCCAGATGTGTTCCAGCAGCTTCTGCCGGCGCGGTGTCGCCAGCAGCGATGCGGCCGATTCCGGTTGCAGCAGCCCTTTCGGGAGATCGGTGACGGGTGCTGGCGACGGAGCGGCAGCGACCGGAGGCCGTTTCCGCTGGAACAGAGAGAGCATGTGGGTGTCCTGGTGGCGGGCAAGCGGGCGGCCTTTTCGCCTTTTCGGGTAGGGCCTTTCCCCTTGCACCCCATTCCCTTGCCATTTCGGCCCTTTACAGCCTTTGGGTATAGGGCGACGGGTGCCGGCCGTCCACCTCCAATACGAGTTGCGGCAGGCCGGATTGATGCAGGAAGGCTGGCTGTTTACGCCTTACGATGGACCGATTCTTGGACTCGGGAGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14452 GenBank   CAP44603
Name   TraI_2_Bpet4254_ICE-GI6 insolico UniProt ID   _
Length   617 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 617 a.a.        Molecular weight: 67533.79 Da        Isoelectric Point: 6.8198

>CAP44603.1 putative helicase [Bordetella petrii]
MLSLFQRKRPPVAAAPSPAPVTDLPKGLLQPESAASLLATPRRQKLLEHIWQRTSLSRRQFATLYRTPLE
RYAELVQAFPASEAHHHAYPGGMLDHGLEIVAYSLKLRQSHLLPIGASPEDQAAQEEAWTAAVAYAALLH
DVGKIAVDLHVELADGNTWHPWHGPLRQPYRFRYRDDREYRLHSAATGLLYRQLLDREVLDWLSCYPSLW
APLLYVLAGQYEHAGVLGELVVQADRASVAQELGGDPTRAMAAPKHALQRKLLEGLRYLLKEELKLNQPE
ASDGWLTDGALWLVSKTVSDKLRAHLLSQGVDGIPANNTAVFNVLQDHGMLQPTPDGKAIWRATVTSSTG
WTHLFTLLRLAPALIWESGERPAPFAGTVTTDAALAGEAAEAAATLSADGAASASENQNAPPAEGSGIVS
ASPPKAQASPDVMADMLAMVGMGDSSTTEDVETAPDEVPAALPDATQPPLAAAAPSSPAFTSSTTQPSGE
HFMAWLKHGIATRRLIINDAKALVHTVSDTAYLVSPGVFQRYAQEHPQVGKLAKQENLQDWQWVQKRFER
LQLHRKQPSGLNIWTCEVTGARKSRKLHGYLLIKPEMVFEFTPPNNPYLFSMKFPGL

  Protein domains


Predicted by InterproScan.

(488-609)

(27-340)


  Protein structure



No available structure.




T4CP


ID   17057 GenBank   CAP44549
Name   t4cp2_Bpetpseudo_15_ICE-GI6 insolico UniProt ID   _
Length   482 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 482 a.a.        Molecular weight: 53316.97 Da        Isoelectric Point: 8.4230

>CAP44549.1 pseudogene [Bordetella petrii]
MCLSTLCGRCRPWGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNAAGE
HEVVIVIDPKGDADLLKRMYVEAKRAGRDGEFYIFHLGWPEISARYNAVGRFGRISEFATRIAGQLSGEG
NSAAFREFAWRFVNIIARALVEQGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAKLN
EKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLEKLTSGKIAQLLA
PNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEFAAAVGNSMFSDLVSVAGHIYKHGIDDGVPGASA
GTRVPINVHADEFNELMGDEFMPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQVIGNFNNLFMLRV
RETATAELLTRQLPKVEVYTTTIVSGATDASDSRFSTVRVFFLASTPSSAASSSAFRSSRAC

  Protein domains


Predicted by InterproScan.

(356-452)

  Protein structure



No available structure.



ID   17058 GenBank   CAP44594
Name   tcpA_Bpet4245_ICE-GI6 insolico UniProt ID   _
Length   891 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 891 a.a.        Molecular weight: 98576.52 Da        Isoelectric Point: 5.7403

>CAP44594.1 hypothetical conserved protein [Bordetella petrii]
MSESAKDFQSVIFKLHKAIADYQEGCARIDREFNATKKTLNEDQERNRSIRKSNWQAGFVREWESNATAI
ANASAQLRQHQPAFVDFCVDKPLMASEIPAGLVLGSEQVSFEKLSCQSPKVISFPFSSALVFPQGDAEKK
RLAHCLLLRLLSALPAGQVELTLIDPLQQGQSVEPFLPLLKVEQLVPQGHVLTRADEIEAALGQLTDEIE
ELIQLRFNEKASNWLKYNAVQPDAPLPYKVVLLFDVPEQISEKSLWLLGRICENGPRCGVLPIIAIDEQR
MEDRRYEKLNATLKNSTTQLNDLLQRAGAGGLSFTYQPEQWPRQDVLDGFIARLAEDCAARTRFKKTMAD
LWTSFGKEETTLGGFDIPIGWTSAGDLATLRLGATDSEHHVLLAGKTGSGKSNLLHVLIHTLCEKYPTEE
LDLYLLDYKESTEFNIYATPPVPQARLVATESDPEYGVTVLRHLVDELETRARIFKSKNVNDFSEYRKSS
GVRLPRALLVIDEFQILFSESRQVAEAAEQLLSKLLKQGRSFGIHILLATQTLKGINAQSIGSIITQLGC
RIALACGQEDSAMILGGGNWAAAELRSPPEGIINNANGAKSGNVKFMIPFAGESEHRRDLLTKLIARTSL
SGVAEKTKIFSGAFLPQIPSPFEYQTACAHEEALLLGENLAFDSKPLTVPLTRRSAFNVLFSGYNDHIHD
GLLSATLFSLTFVDGFDEIVYFNARGVPPGGGFSAAAQMLGARLKMFDDISDLPLQAISDDIGNRRVALI
IDGLDSEKALQPAPAFRSLKPGEPPTPADLLKRLAEDGPRKGTFVFIFVDRWQRCASASKDLFSFFELRV
AYCMNEDDAGSLVSGGVGKFKGIEKPSRAVFVNKMTNDITWFRPYVQESTR

  Protein domains


Predicted by InterproScan.

(387-566)

  Protein structure



No available structure.



ID   17059 GenBank   CAP44624
Name   t4cp2_Bpet4275_ICE-GI6 insolico UniProt ID   _
Length   575 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 575 a.a.        Molecular weight: 63348.16 Da        Isoelectric Point: 5.5384

>CAP44624.1 hypothetical protein Bpet4275 [Bordetella petrii]
MCLSTLCGRCRPWGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRKNAAGE
HEVVIVIDPKGDADLLKRMYVEAKRAGRDGEFYIFHLGWPEISARYNAVGRFGRISEFATRIAGQLSGEG
NSAAFREFAWRFVNIIARALVEQGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAKLN
EKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLEKLTSGKIAQLLA
PNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKHGIDDGLPGASA
GSRVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQVIGNFNNLFMLRV
RETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPSHIVGLPKGQCFA
LLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGHMRQSYSEATQWWEFTSSPVLQDAALPDDLLDETAIAT
PTTGTGDTASEEAAP

  Protein domains


Predicted by InterproScan.

(356-484)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1133464..1153678

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet1062 1129184..1129504 + 321 CAP41394 hypothetical protein predicted by Glimmer/Critica -
Bpet1063 1129594..1129899 + 306 CAP41395 conserved hypothetical protein -
Bpet1064 1130008..1132320 + 2313 CAP41396 conserved plasmid related protein -
Bpet1065 1132434..1133303 + 870 CAP41397 conserved hypothetical protein -
Bpet1066 1133464..1134063 + 600 CAP41398 putative secreted protein tfc2
Bpet1067 1134060..1134704 + 645 CAP41399 putative membrane protein -
Bpet1068 1134719..1135444 + 726 CAP41400 conserved protein, putatively exported tfc3
Bpet1069 1135426..1136031 + 606 CAP41401 conserved exported protein virB1
Bpet1070 1136028..1136576 + 549 CAP41402 putative exported protein tfc5
Bpet1071 1136581..1138770 + 2190 CAP41403 putative membrane protein -
Bpet1072 1138767..1139516 + 750 CAP41404 putative membrane protein tfc7
Bpet1073 1139615..1139998 + 384 CAP41405 putative membrane protein tfc8
Bpet1074 1139995..1140228 + 234 CAP41406 conserved hypothetical protein tfc9
Bpet1075 1140245..1140604 + 360 CAP41407 conserved hypothetical protein tfc10
Bpet1076 1140617..1141027 + 411 CAP41408 conserved hypothetical protein tfc11
Bpet1077 1141024..1141716 + 693 CAP41409 conserved hypothetical protein tfc12
Bpet1078 1141713..1142630 + 918 CAP41410 hypothetical protein tfc13
Bpet1079 1142620..1144038 + 1419 CAP41411 putative exported protein tfc14
Bpet1080 1144019..1144468 + 450 CAP41412 putative lipoprotein tfc15
Bpet1081 1144468..1147356 + 2889 CAP41413 conserved hypothetical protein virb4
Bpet1082 1147370..1148134 + 765 CAP41414 conserved hypothetical protein -
Bpet1083 1148309..1148803 + 495 CAP41415 DNA repair protein radC homolog -
Bpet1084 1148967..1149413 + 447 CAP41416 putative secreted protein tfc24
Bpet1085 1149440..1150357 + 918 CAP41417 conserved hypothetical protein tfc23
Bpet1086 1150367..1151761 + 1395 CAP41418 conserved hypothetical protein tfc22
Bpet1087 1151758..1152117 + 360 CAP41419 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet1088 1152131..1153678 + 1548 CAP41420 conserved hypothetical protein tfc19
Bpet1089 1153706..1154071 - 366 CAP41421 conserved hypothetical protein -
Bpet1090 1154153..1154785 - 633 CAP41422 conserved hypothetical protein -
Bpet1091 1154798..1155424 - 627 CAP41423 conserved hypothetical protein -
Bpet1092 1155741..1157603 + 1863 CAP41424 putative helicase -
Bpet1093 1157673..1158167 - 495 CAP41425 conserved hypothetical protein -

Region 2: 1530709..1556286

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet1476 1527718..1529565 + 1848 CAP41811 conserved plasmid related protein -
Bpet1477 1529679..1530548 + 870 CAP41812 hypothetical protein predicted by Glimmer/Critica -
Bpet1478 1530709..1531308 + 600 CAP41813 putative secreted protein tfc2
Bpet1479 1531305..1531955 + 651 CAP41814 putative membrane protein -
Bpet1480 1531970..1532689 + 720 CAP41815 conserved protein, putatively exported tfc3
Bpet1481 1532671..1533261 + 591 CAP41816 conserved exported protein virB1
Bpet1482 1533258..1533806 + 549 CAP41817 conserved hypothetical protein tfc5
Bpet1483 1533811..1535997 + 2187 CAP41818 putative plasmid-transfer-protein -
Bpet1484 1535994..1536743 + 750 CAP41819 putative Membrane protein tfc7
Bpet1485 1536780..1537184 - 405 CAP41820 conserved hypothetical protein -
Bpet1486 1537370..1537753 + 384 CAP41821 putative membrane protein tfc8
Bpet1487 1537750..1537983 + 234 CAP41822 conserved hypothetical protein tfc9
Bpet1488 1537994..1538359 + 366 CAP41823 conserved hypothetical protein tfc10
Bpet1489 1538372..1538782 + 411 CAP41824 putative membrane protein tfc11
Bpet1490 1538779..1539471 + 693 CAP41825 conserved hypothetical protein tfc12
Bpet1491 1539468..1540400 + 933 CAP41826 putative secreted protein tfc13
Bpet1492 1540390..1541808 + 1419 CAP41827 putative exported protein tfc14
Bpet1493 1541789..1542229 + 441 CAP41828 putative lipoprotein tfc15
bp050705_PS_02 1542229..1546381 + 4153 Protein_1497 - -
Bpetpseudo_04 1542229..1543317 + 1089 CAP41829 pseudogene virb4
Bpet1494 1543350..1543637 + 288 CAP41831 transposase -
Bpet1495 1543634..1544524 + 891 CAP41832 probable transposase -
Bpetpseudo_05 1544570..1546381 + 1812 CAP41833 pseudogene virb4
Bpet1496 1546395..1547159 + 765 CAP41834 putative protein-disulfide isomerase -
Bpet1497 1547343..1547789 + 447 CAP41835 putative DNA repair protein RadC -
Bpet1498 1547845..1549104 + 1260 CAP41836 putative integrase/recombinase -
Bpet1499 1549101..1550093 + 993 CAP41837 putative integrase/recombinase -
Bpet1500 1550090..1551100 + 1011 CAP41838 putative integrase/recombinase -
Bpet1501 1551600..1552046 + 447 CAP41839 conserved hypothetical protein tfc24
Bpet1502 1551923..1552990 + 1068 CAP41840 conserved hypothetical protein tfc23
Bpet1503 1553000..1554397 + 1398 CAP41841 conserved hypothetical protein tfc22
Bpet1504 1554394..1554753 + 360 CAP41842 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet1505 1554769..1556286 + 1518 CAP41843 conserved hypothetical protein tfc19
Bpet1506 1556300..1556677 - 378 CAP41844 putative transposon -
Bpet1507 1556705..1557163 - 459 CAP41845 conserved hypothetical protein -
Bpet1508 1557163..1557480 - 318 CAP41846 probable suppressor protein -
Bpet1509 1557786..1559633 + 1848 CAP41847 putative helicase -
Bpet1510 1559933..1560112 - 180 CAP41848 putative transposon -
Bpet1511 1560148..1560621 - 474 CAP41849 putative transcriptional regulator -

Region 3: 4518452..4538705

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet4254 4515132..4516985 - 1854 CAP44603 putative helicase -
Bpet4255 4517283..4517600 + 318 CAP44604 probable suppressor protein -
Bpet4256 4517600..4518058 + 459 CAP44605 hypothetical protein -
Bpet4257 4518086..4518445 + 360 CAP44606 putative membrane protein -
Bpet4258 4518452..4519975 - 1524 CAP44607 conserved Hypothetical protein tfc19
Bpet4259 4519991..4520362 - 372 CAP44608 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet4260 4520359..4521765 - 1407 CAP44609 conserved hypothetical protein tfc22
Bpet4261 4521776..4522723 - 948 CAP44610 conserved hypothetical protein tfc23
Bpet4262 4522720..4523166 - 447 CAP44611 putative secreted protein tfc24
Bpet4263 4523331..4523825 - 495 CAP44612 DNA repair protein radC homolog -
Bpet4264 4524004..4524741 - 738 CAP44613 putative secreted protein -
Bpet4265 4524784..4527693 - 2910 CAP44614 conserved hypothetical protein virb4
Bpet4266 4527693..4528142 - 450 CAP44615 putative lipoprotein tfc15
Bpet4267 4528123..4529532 - 1410 CAP44616 putative exported protein tfc14
Bpet4268 4529522..4530460 - 939 CAP44617 putative secreted protein tfc13
Bpet4269 4530457..4531149 - 693 CAP44618 conserved hypothetical protein tfc12
Bpet4270 4531146..4531556 - 411 CAP44619 conserved hypothetical protein tfc11
Bpet4271 4531570..4531929 - 360 CAP44620 putative membrane protein tfc10
Bpet4272 4531946..4532179 - 234 CAP44621 putative membrane protein tfc9
Bpet4273 4532176..4532559 - 384 CAP44622 putative membrane protein tfc8
Bpet4274 4532658..4533419 - 762 CAP44623 putative membrane protein tfc7
Bpet4275 4533416..4535143 - 1728 CAP44624 hypothetical protein -
Bpet4276 4534929..4535600 - 672 CAP44625 hypothetical protein -
Bpet4277 4535605..4536153 - 549 CAP44626 conserved exported protein tfc5
Bpet4278 4536150..4536755 - 606 CAP44627 conserved exported protein virB1
Bpet4279 4536737..4537474 - 738 CAP44628 conserved protein, putatively exported tfc3
Bpet4280 4537489..4538130 - 642 CAP44629 putative membrane protein -
Bpet4281 4538127..4538705 - 579 CAP44630 putative lipoprotein tfc2
Bpet4282 4538848..4540500 - 1653 CAP44631 hypothetical protein predicted by Glimmer/Critica -
Bpet4283 4540566..4542368 - 1803 CAP44632 conserved hypothetical protein -


Host bacterium


ID   400 Element type   ICE (Integrative and conjugative element)
Element name   ICE-GI1 GenBank   AM902716
Element size   5287950 bp Coordinate of oriT [Strand]   19222..19539 [-]
Host bacterium   Bordetella petrii strain DSM 12804 Coordinate of element   1083989..1339502

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   arsC
Degradation gene   bphA1, linJ
Symbiosis gene   -
Anti-CRISPR   -