Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200450 |
| Name | oriT_ICE-GI3  |
| Organism | Bordetella petrii strain DSM 12804 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | AM902716 (_) |
| oriT length | 240 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 240 nt
>oriT_ICE-GI3
TGTGGGTGTCCTAGTGGCGGGCCGACCGGGAGGCCTTTTGCCTTTTCGAGGTAGGGCCTTTCCCCTTGCAGCCCCTTCCATTGCCCTTTCGGCCCTTTGGCCTTTAACCATTTGGATATAGGGCGGCGTGCGCTTGCCGTCCACCACCAATGCGGGTTGCAGCGAGCCGGATTGGTGCGTGAAGGCTCGCTGTTCCCCCCCATACGATGGCCCGATTCTTGGACTCTGGAGAGCATCATG
TGTGGGTGTCCTAGTGGCGGGCCGACCGGGAGGCCTTTTGCCTTTTCGAGGTAGGGCCTTTCCCCTTGCAGCCCCTTCCATTGCCCTTTCGGCCCTTTGGCCTTTAACCATTTGGATATAGGGCGGCGTGCGCTTGCCGTCCACCACCAATGCGGGTTGCAGCGAGCCGGATTGGTGCGTGAAGGCTCGCTGTTCCCCCCCATACGATGGCCCGATTCTTGGACTCTGGAGAGCATCATG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 14451 | GenBank | CAP41847 |
| Name | TraI_2_Bpet1509_ICE-GI3 |
UniProt ID | _ |
| Length | 615 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 615 a.a. Molecular weight: 67405.62 Da Isoelectric Point: 7.4238
>CAP41847.1 putative helicase [Bordetella petrii]
MLSLFQRKRPVVASAPSPAPSNDLPKGRLRPESAASLLATPRRQKLLEHIWQRTSLSRKQFATLYRAPLE
RYAELVQRFPASEAHHHAYPGGMLDHGLEIVAYALKLRQSHLLPAGSTPEDQAAQSEAWTAAVAYAALLH
DVGKLAVDLHVELADGSTWHPWHGPLRQPYRFRYREDREYRLHSAATGLLYRQLLDAQLLDWLSGYPALW
GPLLYVLAGQYEHAGVLGELVVQADRASVAQDLGGDPARAMAAPKHALQRKLLDGLRYLLKEELKLNQPE
ASDGWLTEDALWLVSKTVSDKLRAHLLSQGIDGIPANNTAVFNVLQDHGMLHPTTDGKAVWRATVTSATG
WSHSFTLLRLAPALIWEPGERPVPFAGTVAIDAVPNDKSVAQPAAVAETTQEGQEAPPWESSSVAVPSPA
TQTVPDVLEDMLAMVGMGNSSGTQQDEEATSHAADATPSEAPMPAMAAASPPSPVPPAAPSSATAQPSGE
HFMAWLKQGIVSRRLIINDAKALVHTVSDTAYLVSPGVFQRYAREHPQVGMLAKQESQQDWQWVQKRFEK
LQLHRKHINGLNVWACSVTGSRKSRQLHGYLLRDPLPLFGKVPPNNPYLSILQSI
MLSLFQRKRPVVASAPSPAPSNDLPKGRLRPESAASLLATPRRQKLLEHIWQRTSLSRKQFATLYRAPLE
RYAELVQRFPASEAHHHAYPGGMLDHGLEIVAYALKLRQSHLLPAGSTPEDQAAQSEAWTAAVAYAALLH
DVGKLAVDLHVELADGSTWHPWHGPLRQPYRFRYREDREYRLHSAATGLLYRQLLDAQLLDWLSGYPALW
GPLLYVLAGQYEHAGVLGELVVQADRASVAQDLGGDPARAMAAPKHALQRKLLDGLRYLLKEELKLNQPE
ASDGWLTEDALWLVSKTVSDKLRAHLLSQGIDGIPANNTAVFNVLQDHGMLHPTTDGKAVWRATVTSATG
WSHSFTLLRLAPALIWEPGERPVPFAGTVAIDAVPNDKSVAQPAAVAETTQEGQEAPPWESSSVAVPSPA
TQTVPDVLEDMLAMVGMGNSSGTQQDEEATSHAADATPSEAPMPAMAAASPPSPVPPAAPSSATAQPSGE
HFMAWLKQGIVSRRLIINDAKALVHTVSDTAYLVSPGVFQRYAREHPQVGMLAKQESQQDWQWVQKRFEK
LQLHRKHINGLNVWACSVTGSRKSRQLHGYLLRDPLPLFGKVPPNNPYLSILQSI
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4CP
| ID | 17056 | GenBank | CAP41818 |
| Name | t4cp2_Bpet1483_ICE-GI3 |
UniProt ID | _ |
| Length | 728 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 728 a.a. Molecular weight: 80862.63 Da Isoelectric Point: 7.6092
>CAP41818.1 putative plasmid-transfer-protein [Bordetella petrii]
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYRDARVILRYRR
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLTRRLEERLEFAR
FPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNAAGEHEVVIVIDPKGDADLLKRMYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HIVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGAL
PDDLLDDAAAVEPGLVATDDSAGNEASP
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYRDARVILRYRR
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLTRRLEERLEFAR
FPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPEEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNAAGEHEVVIVIDPKGDADLLKRMYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HIVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPQDLQQLAGYMRQSYSEATQWWEFTSSPALQDGAL
PDDLLDDAAAVEPGLVATDDSAGNEASP
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1133464..1153678
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bpet1062 | 1129184..1129504 | + | 321 | CAP41394 | hypothetical protein predicted by Glimmer/Critica | - |
| Bpet1063 | 1129594..1129899 | + | 306 | CAP41395 | conserved hypothetical protein | - |
| Bpet1064 | 1130008..1132320 | + | 2313 | CAP41396 | conserved plasmid related protein | - |
| Bpet1065 | 1132434..1133303 | + | 870 | CAP41397 | conserved hypothetical protein | - |
| Bpet1066 | 1133464..1134063 | + | 600 | CAP41398 | putative secreted protein | tfc2 |
| Bpet1067 | 1134060..1134704 | + | 645 | CAP41399 | putative membrane protein | - |
| Bpet1068 | 1134719..1135444 | + | 726 | CAP41400 | conserved protein, putatively exported | tfc3 |
| Bpet1069 | 1135426..1136031 | + | 606 | CAP41401 | conserved exported protein | virB1 |
| Bpet1070 | 1136028..1136576 | + | 549 | CAP41402 | putative exported protein | tfc5 |
| Bpet1071 | 1136581..1138770 | + | 2190 | CAP41403 | putative membrane protein | - |
| Bpet1072 | 1138767..1139516 | + | 750 | CAP41404 | putative membrane protein | tfc7 |
| Bpet1073 | 1139615..1139998 | + | 384 | CAP41405 | putative membrane protein | tfc8 |
| Bpet1074 | 1139995..1140228 | + | 234 | CAP41406 | conserved hypothetical protein | tfc9 |
| Bpet1075 | 1140245..1140604 | + | 360 | CAP41407 | conserved hypothetical protein | tfc10 |
| Bpet1076 | 1140617..1141027 | + | 411 | CAP41408 | conserved hypothetical protein | tfc11 |
| Bpet1077 | 1141024..1141716 | + | 693 | CAP41409 | conserved hypothetical protein | tfc12 |
| Bpet1078 | 1141713..1142630 | + | 918 | CAP41410 | hypothetical protein | tfc13 |
| Bpet1079 | 1142620..1144038 | + | 1419 | CAP41411 | putative exported protein | tfc14 |
| Bpet1080 | 1144019..1144468 | + | 450 | CAP41412 | putative lipoprotein | tfc15 |
| Bpet1081 | 1144468..1147356 | + | 2889 | CAP41413 | conserved hypothetical protein | virb4 |
| Bpet1082 | 1147370..1148134 | + | 765 | CAP41414 | conserved hypothetical protein | - |
| Bpet1083 | 1148309..1148803 | + | 495 | CAP41415 | DNA repair protein radC homolog | - |
| Bpet1084 | 1148967..1149413 | + | 447 | CAP41416 | putative secreted protein | tfc24 |
| Bpet1085 | 1149440..1150357 | + | 918 | CAP41417 | conserved hypothetical protein | tfc23 |
| Bpet1086 | 1150367..1151761 | + | 1395 | CAP41418 | conserved hypothetical protein | tfc22 |
| Bpet1087 | 1151758..1152117 | + | 360 | CAP41419 | hypothetical protein predicted by Glimmer/Critica | tfc18 |
| Bpet1088 | 1152131..1153678 | + | 1548 | CAP41420 | conserved hypothetical protein | tfc19 |
| Bpet1089 | 1153706..1154071 | - | 366 | CAP41421 | conserved hypothetical protein | - |
| Bpet1090 | 1154153..1154785 | - | 633 | CAP41422 | conserved hypothetical protein | - |
| Bpet1091 | 1154798..1155424 | - | 627 | CAP41423 | conserved hypothetical protein | - |
| Bpet1092 | 1155741..1157603 | + | 1863 | CAP41424 | putative helicase | - |
| Bpet1093 | 1157673..1158167 | - | 495 | CAP41425 | conserved hypothetical protein | - |
Region 2: 1530709..1556286
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bpet1476 | 1527718..1529565 | + | 1848 | CAP41811 | conserved plasmid related protein | - |
| Bpet1477 | 1529679..1530548 | + | 870 | CAP41812 | hypothetical protein predicted by Glimmer/Critica | - |
| Bpet1478 | 1530709..1531308 | + | 600 | CAP41813 | putative secreted protein | tfc2 |
| Bpet1479 | 1531305..1531955 | + | 651 | CAP41814 | putative membrane protein | - |
| Bpet1480 | 1531970..1532689 | + | 720 | CAP41815 | conserved protein, putatively exported | tfc3 |
| Bpet1481 | 1532671..1533261 | + | 591 | CAP41816 | conserved exported protein | virB1 |
| Bpet1482 | 1533258..1533806 | + | 549 | CAP41817 | conserved hypothetical protein | tfc5 |
| Bpet1483 | 1533811..1535997 | + | 2187 | CAP41818 | putative plasmid-transfer-protein | - |
| Bpet1484 | 1535994..1536743 | + | 750 | CAP41819 | putative Membrane protein | tfc7 |
| Bpet1485 | 1536780..1537184 | - | 405 | CAP41820 | conserved hypothetical protein | - |
| Bpet1486 | 1537370..1537753 | + | 384 | CAP41821 | putative membrane protein | tfc8 |
| Bpet1487 | 1537750..1537983 | + | 234 | CAP41822 | conserved hypothetical protein | tfc9 |
| Bpet1488 | 1537994..1538359 | + | 366 | CAP41823 | conserved hypothetical protein | tfc10 |
| Bpet1489 | 1538372..1538782 | + | 411 | CAP41824 | putative membrane protein | tfc11 |
| Bpet1490 | 1538779..1539471 | + | 693 | CAP41825 | conserved hypothetical protein | tfc12 |
| Bpet1491 | 1539468..1540400 | + | 933 | CAP41826 | putative secreted protein | tfc13 |
| Bpet1492 | 1540390..1541808 | + | 1419 | CAP41827 | putative exported protein | tfc14 |
| Bpet1493 | 1541789..1542229 | + | 441 | CAP41828 | putative lipoprotein | tfc15 |
| bp050705_PS_02 | 1542229..1546381 | + | 4153 | Protein_1497 | - | - |
| Bpetpseudo_04 | 1542229..1543317 | + | 1089 | CAP41829 | pseudogene | virb4 |
| Bpet1494 | 1543350..1543637 | + | 288 | CAP41831 | transposase | - |
| Bpet1495 | 1543634..1544524 | + | 891 | CAP41832 | probable transposase | - |
| Bpetpseudo_05 | 1544570..1546381 | + | 1812 | CAP41833 | pseudogene | virb4 |
| Bpet1496 | 1546395..1547159 | + | 765 | CAP41834 | putative protein-disulfide isomerase | - |
| Bpet1497 | 1547343..1547789 | + | 447 | CAP41835 | putative DNA repair protein RadC | - |
| Bpet1498 | 1547845..1549104 | + | 1260 | CAP41836 | putative integrase/recombinase | - |
| Bpet1499 | 1549101..1550093 | + | 993 | CAP41837 | putative integrase/recombinase | - |
| Bpet1500 | 1550090..1551100 | + | 1011 | CAP41838 | putative integrase/recombinase | - |
| Bpet1501 | 1551600..1552046 | + | 447 | CAP41839 | conserved hypothetical protein | tfc24 |
| Bpet1502 | 1551923..1552990 | + | 1068 | CAP41840 | conserved hypothetical protein | tfc23 |
| Bpet1503 | 1553000..1554397 | + | 1398 | CAP41841 | conserved hypothetical protein | tfc22 |
| Bpet1504 | 1554394..1554753 | + | 360 | CAP41842 | hypothetical protein predicted by Glimmer/Critica | tfc18 |
| Bpet1505 | 1554769..1556286 | + | 1518 | CAP41843 | conserved hypothetical protein | tfc19 |
| Bpet1506 | 1556300..1556677 | - | 378 | CAP41844 | putative transposon | - |
| Bpet1507 | 1556705..1557163 | - | 459 | CAP41845 | conserved hypothetical protein | - |
| Bpet1508 | 1557163..1557480 | - | 318 | CAP41846 | probable suppressor protein | - |
| Bpet1509 | 1557786..1559633 | + | 1848 | CAP41847 | putative helicase | - |
| Bpet1510 | 1559933..1560112 | - | 180 | CAP41848 | putative transposon | - |
| Bpet1511 | 1560148..1560621 | - | 474 | CAP41849 | putative transcriptional regulator | - |
Region 3: 4518452..4538705
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bpet4254 | 4515132..4516985 | - | 1854 | CAP44603 | putative helicase | - |
| Bpet4255 | 4517283..4517600 | + | 318 | CAP44604 | probable suppressor protein | - |
| Bpet4256 | 4517600..4518058 | + | 459 | CAP44605 | hypothetical protein | - |
| Bpet4257 | 4518086..4518445 | + | 360 | CAP44606 | putative membrane protein | - |
| Bpet4258 | 4518452..4519975 | - | 1524 | CAP44607 | conserved Hypothetical protein | tfc19 |
| Bpet4259 | 4519991..4520362 | - | 372 | CAP44608 | hypothetical protein predicted by Glimmer/Critica | tfc18 |
| Bpet4260 | 4520359..4521765 | - | 1407 | CAP44609 | conserved hypothetical protein | tfc22 |
| Bpet4261 | 4521776..4522723 | - | 948 | CAP44610 | conserved hypothetical protein | tfc23 |
| Bpet4262 | 4522720..4523166 | - | 447 | CAP44611 | putative secreted protein | tfc24 |
| Bpet4263 | 4523331..4523825 | - | 495 | CAP44612 | DNA repair protein radC homolog | - |
| Bpet4264 | 4524004..4524741 | - | 738 | CAP44613 | putative secreted protein | - |
| Bpet4265 | 4524784..4527693 | - | 2910 | CAP44614 | conserved hypothetical protein | virb4 |
| Bpet4266 | 4527693..4528142 | - | 450 | CAP44615 | putative lipoprotein | tfc15 |
| Bpet4267 | 4528123..4529532 | - | 1410 | CAP44616 | putative exported protein | tfc14 |
| Bpet4268 | 4529522..4530460 | - | 939 | CAP44617 | putative secreted protein | tfc13 |
| Bpet4269 | 4530457..4531149 | - | 693 | CAP44618 | conserved hypothetical protein | tfc12 |
| Bpet4270 | 4531146..4531556 | - | 411 | CAP44619 | conserved hypothetical protein | tfc11 |
| Bpet4271 | 4531570..4531929 | - | 360 | CAP44620 | putative membrane protein | tfc10 |
| Bpet4272 | 4531946..4532179 | - | 234 | CAP44621 | putative membrane protein | tfc9 |
| Bpet4273 | 4532176..4532559 | - | 384 | CAP44622 | putative membrane protein | tfc8 |
| Bpet4274 | 4532658..4533419 | - | 762 | CAP44623 | putative membrane protein | tfc7 |
| Bpet4275 | 4533416..4535143 | - | 1728 | CAP44624 | hypothetical protein | - |
| Bpet4276 | 4534929..4535600 | - | 672 | CAP44625 | hypothetical protein | - |
| Bpet4277 | 4535605..4536153 | - | 549 | CAP44626 | conserved exported protein | tfc5 |
| Bpet4278 | 4536150..4536755 | - | 606 | CAP44627 | conserved exported protein | virB1 |
| Bpet4279 | 4536737..4537474 | - | 738 | CAP44628 | conserved protein, putatively exported | tfc3 |
| Bpet4280 | 4537489..4538130 | - | 642 | CAP44629 | putative membrane protein | - |
| Bpet4281 | 4538127..4538705 | - | 579 | CAP44630 | putative lipoprotein | tfc2 |
| Bpet4282 | 4538848..4540500 | - | 1653 | CAP44631 | hypothetical protein predicted by Glimmer/Critica | - |
| Bpet4283 | 4540566..4542368 | - | 1803 | CAP44632 | conserved hypothetical protein | - |
Host bacterium
| ID | 400 | Element type | ICE (Integrative and conjugative element) |
| Element name | ICE-GI1 | GenBank | AM902716 |
| Element size | 5287950 bp | Coordinate of oriT [Strand] | 19222..19539 [-] |
| Host bacterium | Bordetella petrii strain DSM 12804 | Coordinate of element | 1083989..1339502 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | arsC |
| Degradation gene | bphA1, linJ |
| Symbiosis gene | - |
| Anti-CRISPR | - |