Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200449
Name   oriT_ICE-GI1 in_silico
Organism   Bordetella petrii strain DSM 12804
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   AM902716 (19222..19539 [-], 318 nt)
oriT length   318 nt
IRs (inverted repeats)      199..206, 215..222  (TAAAAGGC..GCCTTTTA)
 197..202, 207..212  (TTTAAA..TTTAAA)
 71..76, 86..91  (TTCCAC..GTGGAA)
 34..39, 41..46  (GGAACG..CGTTCC)
 20..26, 29..35  (CCTGCGC..GCGCAGG)
Location of nic site      19..20
Conserved sequence flanking the
  nic site    		  TCGTGCCTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 318 nt

>oriT_ICE-GI1
CCATGGCCGAGCGGTCGTGCCTGCGCCAGCGCAGGAACGTCGTTCCCGCGCCAGTGGTCTGCTGGGCCAGTTCCACGGGCAGCAGGTGGAAGGGATGCCCACTGGCCTGTTGCAGCACTTGTCGCTGCGCCAGGCCGATCAACTCGTCGCGCATGGCGAAGCACTGGCTGGCCCAGGCCTCCAAGTCCCCTTTACCTTTAAAAGGCTTTAAAAGGCCTTTTAGAGAGGCCGCGTGTTCCAGGCGCATGAAGGCTCCCTGTTGCAGGCCCCGGAAGTAGCGGGTCGGCTGGTTCAGATCGCTCATGCGGATTCGTCCTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14449 GenBank   CAP41424
Name   TraI_2_Bpet1092_ICE-GI1 insolico UniProt ID   _
Length   620 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 620 a.a.        Molecular weight: 68291.73 Da        Isoelectric Point: 6.5901

>CAP41424.1 putative helicase [Bordetella petrii]
MLSLFQRKRPPVAAAPTLPPATDLPKGLLRPESAASLLATPRRQKLLEYIWQRTSLSRRQFATLYRAPLE
RYAELVQAFPASEAHHHAYSGGMLDHGLEIVAYSLKLRQSLLLPIGASPEDQAAQAEAWTAAVAYAALLH
DIGKIAVDLHVELADGSLWHPWYGPLHQPYRFRYREDREYRLHSAATGLLYRQLLDTQLLDWLSGYPDLW
GPLLYVLAGQYEHAGVLGELVVQADRASVAQELGGDPTRAMAAPKHALQRKLLDGLRYLLKEQLKLNQPE
ASDGWLTEDGLWLVSKTVSDKLRAHLLSQGIDGIPANNTAVFNVLQDHGMLQPTSDGKAVWRATVTSSTG
WSHSFTLLRLAPALIWEPGERPASFAGTVMVDATPAENDPGAPATQPTTGMLPAPESQKTPPWEGGNTVV
IASPLIAGPMLDVMEDMLAMVGMNDTPGTAPEATANADSVHSERIEPSVPATAVVTCQSTVRQAELSREA
AQPSGEHFTSWLKQGVASRRLIINDAKALVHTVNDTAYLVSPGVFQRYAQEHPEVGMLAKQENLQDWQWV
QKRFERLQLHRKQPSGLNIWTCEVTGPRKSRRLHGYLLDDAQLLFAETPPSNPYLSLLAP

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(27-340)

Putative conjugal transfer nickase/helicase TraI C-term (TraI_2_C)

(494-616)


  Protein structure



No available structure.




T4CP

ID   17053 GenBank   CAP41403
Name   t4cp2_Bpet1071_ICE-GI1 insolico UniProt ID   _
Length   729 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 729 a.a.        Molecular weight: 80819.52 Da        Isoelectric Point: 7.3461

>CAP41403.1 putative membrane protein [Bordetella petrii]
MSGKQPVEVLLRPAVELYTVAACAGAAFLCLVAPWSLALSPSMGVGSALAFGAYGAIRYRDARVILRYRR
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLARRLEERLEFAP
FPLSRLPALTGWDVPINPVRPLPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNPAGEHEVVIVIDPKGDADLLKRMYVEAQRAGREGEFYIFHLGWPEISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLNDPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGADVRVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISSTSVPMIEPS
HVVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLRQLAGYMRQSYSEATQWWEFTSSAALPHAAL
PDDLLDDAAPAEPDAVATGADDSTGEASP

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(508-636)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1133464..1153678

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet1062 1129184..1129504 + 321 CAP41394 hypothetical protein predicted by Glimmer/Critica -
Bpet1063 1129594..1129899 + 306 CAP41395 conserved hypothetical protein -
Bpet1064 1130008..1132320 + 2313 CAP41396 conserved plasmid related protein -
Bpet1065 1132434..1133303 + 870 CAP41397 conserved hypothetical protein -
Bpet1066 1133464..1134063 + 600 CAP41398 putative secreted protein tfc2
Bpet1067 1134060..1134704 + 645 CAP41399 putative membrane protein -
Bpet1068 1134719..1135444 + 726 CAP41400 conserved protein, putatively exported tfc3
Bpet1069 1135426..1136031 + 606 CAP41401 conserved exported protein virB1
Bpet1070 1136028..1136576 + 549 CAP41402 putative exported protein tfc5
Bpet1071 1136581..1138770 + 2190 CAP41403 putative membrane protein -
Bpet1072 1138767..1139516 + 750 CAP41404 putative membrane protein tfc7
Bpet1073 1139615..1139998 + 384 CAP41405 putative membrane protein tfc8
Bpet1074 1139995..1140228 + 234 CAP41406 conserved hypothetical protein tfc9
Bpet1075 1140245..1140604 + 360 CAP41407 conserved hypothetical protein tfc10
Bpet1076 1140617..1141027 + 411 CAP41408 conserved hypothetical protein tfc11
Bpet1077 1141024..1141716 + 693 CAP41409 conserved hypothetical protein tfc12
Bpet1078 1141713..1142630 + 918 CAP41410 hypothetical protein tfc13
Bpet1079 1142620..1144038 + 1419 CAP41411 putative exported protein tfc14
Bpet1080 1144019..1144468 + 450 CAP41412 putative lipoprotein tfc15
Bpet1081 1144468..1147356 + 2889 CAP41413 conserved hypothetical protein virb4
Bpet1082 1147370..1148134 + 765 CAP41414 conserved hypothetical protein -
Bpet1083 1148309..1148803 + 495 CAP41415 DNA repair protein radC homolog -
Bpet1084 1148967..1149413 + 447 CAP41416 putative secreted protein tfc24
Bpet1085 1149440..1150357 + 918 CAP41417 conserved hypothetical protein tfc23
Bpet1086 1150367..1151761 + 1395 CAP41418 conserved hypothetical protein tfc22
Bpet1087 1151758..1152117 + 360 CAP41419 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet1088 1152131..1153678 + 1548 CAP41420 conserved hypothetical protein tfc19
Bpet1089 1153706..1154071 - 366 CAP41421 conserved hypothetical protein -
Bpet1090 1154153..1154785 - 633 CAP41422 conserved hypothetical protein -
Bpet1091 1154798..1155424 - 627 CAP41423 conserved hypothetical protein -
Bpet1092 1155741..1157603 + 1863 CAP41424 putative helicase -
Bpet1093 1157673..1158167 - 495 CAP41425 conserved hypothetical protein -

Region 2: 1530709..1556286

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet1476 1527718..1529565 + 1848 CAP41811 conserved plasmid related protein -
Bpet1477 1529679..1530548 + 870 CAP41812 hypothetical protein predicted by Glimmer/Critica -
Bpet1478 1530709..1531308 + 600 CAP41813 putative secreted protein tfc2
Bpet1479 1531305..1531955 + 651 CAP41814 putative membrane protein -
Bpet1480 1531970..1532689 + 720 CAP41815 conserved protein, putatively exported tfc3
Bpet1481 1532671..1533261 + 591 CAP41816 conserved exported protein virB1
Bpet1482 1533258..1533806 + 549 CAP41817 conserved hypothetical protein tfc5
Bpet1483 1533811..1535997 + 2187 CAP41818 putative plasmid-transfer-protein -
Bpet1484 1535994..1536743 + 750 CAP41819 putative Membrane protein tfc7
Bpet1485 1536780..1537184 - 405 CAP41820 conserved hypothetical protein -
Bpet1486 1537370..1537753 + 384 CAP41821 putative membrane protein tfc8
Bpet1487 1537750..1537983 + 234 CAP41822 conserved hypothetical protein tfc9
Bpet1488 1537994..1538359 + 366 CAP41823 conserved hypothetical protein tfc10
Bpet1489 1538372..1538782 + 411 CAP41824 putative membrane protein tfc11
Bpet1490 1538779..1539471 + 693 CAP41825 conserved hypothetical protein tfc12
Bpet1491 1539468..1540400 + 933 CAP41826 putative secreted protein tfc13
Bpet1492 1540390..1541808 + 1419 CAP41827 putative exported protein tfc14
Bpet1493 1541789..1542229 + 441 CAP41828 putative lipoprotein tfc15
bp050705_PS_02 1542229..1546381 + 4153 Protein_1497 - -
Bpetpseudo_04 1542229..1543317 + 1089 CAP41829 pseudogene virb4
Bpet1494 1543350..1543637 + 288 CAP41831 transposase -
Bpet1495 1543634..1544524 + 891 CAP41832 probable transposase -
Bpetpseudo_05 1544570..1546381 + 1812 CAP41833 pseudogene virb4
Bpet1496 1546395..1547159 + 765 CAP41834 putative protein-disulfide isomerase -
Bpet1497 1547343..1547789 + 447 CAP41835 putative DNA repair protein RadC -
Bpet1498 1547845..1549104 + 1260 CAP41836 putative integrase/recombinase -
Bpet1499 1549101..1550093 + 993 CAP41837 putative integrase/recombinase -
Bpet1500 1550090..1551100 + 1011 CAP41838 putative integrase/recombinase -
Bpet1501 1551600..1552046 + 447 CAP41839 conserved hypothetical protein tfc24
Bpet1502 1551923..1552990 + 1068 CAP41840 conserved hypothetical protein tfc23
Bpet1503 1553000..1554397 + 1398 CAP41841 conserved hypothetical protein tfc22
Bpet1504 1554394..1554753 + 360 CAP41842 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet1505 1554769..1556286 + 1518 CAP41843 conserved hypothetical protein tfc19
Bpet1506 1556300..1556677 - 378 CAP41844 putative transposon -
Bpet1507 1556705..1557163 - 459 CAP41845 conserved hypothetical protein -
Bpet1508 1557163..1557480 - 318 CAP41846 probable suppressor protein -
Bpet1509 1557786..1559633 + 1848 CAP41847 putative helicase -
Bpet1510 1559933..1560112 - 180 CAP41848 putative transposon -
Bpet1511 1560148..1560621 - 474 CAP41849 putative transcriptional regulator -

Region 3: 4518452..4538705

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Bpet4254 4515132..4516985 - 1854 CAP44603 putative helicase -
Bpet4255 4517283..4517600 + 318 CAP44604 probable suppressor protein -
Bpet4256 4517600..4518058 + 459 CAP44605 hypothetical protein -
Bpet4257 4518086..4518445 + 360 CAP44606 putative membrane protein -
Bpet4258 4518452..4519975 - 1524 CAP44607 conserved Hypothetical protein tfc19
Bpet4259 4519991..4520362 - 372 CAP44608 hypothetical protein predicted by Glimmer/Critica tfc18
Bpet4260 4520359..4521765 - 1407 CAP44609 conserved hypothetical protein tfc22
Bpet4261 4521776..4522723 - 948 CAP44610 conserved hypothetical protein tfc23
Bpet4262 4522720..4523166 - 447 CAP44611 putative secreted protein tfc24
Bpet4263 4523331..4523825 - 495 CAP44612 DNA repair protein radC homolog -
Bpet4264 4524004..4524741 - 738 CAP44613 putative secreted protein -
Bpet4265 4524784..4527693 - 2910 CAP44614 conserved hypothetical protein virb4
Bpet4266 4527693..4528142 - 450 CAP44615 putative lipoprotein tfc15
Bpet4267 4528123..4529532 - 1410 CAP44616 putative exported protein tfc14
Bpet4268 4529522..4530460 - 939 CAP44617 putative secreted protein tfc13
Bpet4269 4530457..4531149 - 693 CAP44618 conserved hypothetical protein tfc12
Bpet4270 4531146..4531556 - 411 CAP44619 conserved hypothetical protein tfc11
Bpet4271 4531570..4531929 - 360 CAP44620 putative membrane protein tfc10
Bpet4272 4531946..4532179 - 234 CAP44621 putative membrane protein tfc9
Bpet4273 4532176..4532559 - 384 CAP44622 putative membrane protein tfc8
Bpet4274 4532658..4533419 - 762 CAP44623 putative membrane protein tfc7
Bpet4275 4533416..4535143 - 1728 CAP44624 hypothetical protein -
Bpet4276 4534929..4535600 - 672 CAP44625 hypothetical protein -
Bpet4277 4535605..4536153 - 549 CAP44626 conserved exported protein tfc5
Bpet4278 4536150..4536755 - 606 CAP44627 conserved exported protein virB1
Bpet4279 4536737..4537474 - 738 CAP44628 conserved protein, putatively exported tfc3
Bpet4280 4537489..4538130 - 642 CAP44629 putative membrane protein -
Bpet4281 4538127..4538705 - 579 CAP44630 putative lipoprotein tfc2
Bpet4282 4538848..4540500 - 1653 CAP44631 hypothetical protein predicted by Glimmer/Critica -
Bpet4283 4540566..4542368 - 1803 CAP44632 conserved hypothetical protein -

Host bacterium

ID   400 Element type   ICE (Integrative and conjugative element)
Element name   ICE-GI1 GenBank   AM902716
Element size   5287950 bp Coordinate of oriT [Strand]   19222..19539 [-]
Host bacterium   Bordetella petrii strain DSM 12804 Coordinate of element   1083989..1339502

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   arsC
Degradation gene   bphA1, linJ
Symbiosis gene   -
Anti-CRISPR   -