Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200430
Name   oriT_ICEMsp.SymM2A.F.02 in_silico
Organism   Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   CP034445 (48153..48212 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)      26..34, 36..44  (ACCGCCTCC..GGAGGCGGT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_ICEMsp.SymM2A.F.02
AAAACGATGTGCAGACAAAGATTTAACCGCCTCCTGGAGGCGGTACCTTTATCTTGCCTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   17012 GenBank   AZO03720
Name   t4cp2_EJ068_11885_ICEMsp.SymM2A.F.02 insolico UniProt ID   _
Length   816 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 816 a.a.        Molecular weight: 90415.89 Da        Isoelectric Point: 5.9950

>AZO03720.1 conjugal transfer protein TrbE [Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1]
MLNLSEYRSKADRLADHLPWAALVAPGIVLNKDGSFQRTLRFRGPDLESATEAELVGICARANNALRRLG
SGWALFFEAERTEALGYPNSHFPDAASWLVDEERRAAFEGKVAHYESRYHLTLVFMPPPDAQARAESALV
DSHYSRGERDWRQDLARFRDETNRVLDLFSGFMSEVRVLDDAQTLTYLHGTISPRRHPIMAPETPIYLDA
ILVDAPLTGGLEPMLGEQHLRTLTILGFPNLTRPGILDTLNHQDFAYRWMTRFIPLEKTEATKTLTRLRR
QWFAKRKSIVAILREVITNEPVPLVDNDADNKALDADEALQALGGDHVSFGYLTTTVTVWGEDRQAAAEK
LRAVERIINGLGFTTIREGVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPATNEHLAKV
TQTEAPPLFVAETSGSTPFRLSTHVEDVGHMLVVGPTGAGKSVLLALIALQFRRYAGAQVYVFDKGNSAR
AATLAMGGEHHALGADGSLAFQPLRSINDQASRSWAAEWIASLVAHENVTVTPEVKEAIWSALASLATAP
AQERTLTGLSVLLQSNALKTALMPYTLDGPFGRLLDADHDGLALSDVQCFETEELMHSQGALLPVLTYLF
QRLEERFDGRPTLIMLDEAWVYLDNPLFAARIREWLKVLRKKNVSVVFATQSLADIAGSGIAPAIIESCP
QRIFLPNDRAVEPQARTAYERFGLSERQIELIARATPKRQYYLQSRRGNRLFELELGPIALALCGASDPA
TQTLIDRIMSEDGQGSFASQFLIARGLDWAGELLKQFPQPDKEQFS

  Protein domains


Predicted by InterproScan.

(578-732)

(182-389)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2477533..2486586

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EJ068_11840 2472681..2474300 - 1620 AZO03712 cytochrome-c oxidase, cbb3-type subunit I -
EJ068_11845 2474797..2475540 - 744 AZO03713 Crp/Fnr family transcriptional regulator -
EJ068_11850 2475693..2477042 + 1350 AZO07395 oxygen-independent coproporphyrinogen III oxidase -
EJ068_11855 2477278..2477520 - 243 AZO03714 DUF2274 domain-containing protein -
EJ068_11860 2477533..2478747 - 1215 AZO03715 TrbI/VirB10 family protein virB10
EJ068_11865 2478744..2479781 - 1038 AZO03716 P-type conjugative transfer protein TrbG virB9
EJ068_11870 2479771..2480502 - 732 AZO03717 conjugal transfer protein TrbF virB8
EJ068_11875 2480503..2481825 - 1323 AZO03718 P-type conjugative transfer protein TrbL virB6
EJ068_11880 2481859..2482584 - 726 AZO03719 P-type conjugative transfer protein TrbJ virB5
EJ068_11885 2482581..2485031 - 2451 AZO03720 conjugal transfer protein TrbE virb4
EJ068_11890 2485025..2485297 - 273 AZO03721 conjugal transfer protein virB3
EJ068_11895 2485297..2485605 - 309 AZO03722 conjugal transfer protein TrbC virB2
EJ068_11900 2485618..2486586 - 969 AZO03723 P-type conjugative transfer ATPase TrbB virB11
EJ068_11905 2486583..2486996 - 414 AZO03724 CopG family transcriptional regulator -
EJ068_11910 2487113..2489136 - 2024 Protein_2344 conjugal transfer protein TraG -


Host bacterium


ID   383 Element type   ICE (Integrative and conjugative element)
Element name   ICEMsp.SymM2A.F.02 GenBank   CP034445
Element size   6700763 bp Coordinate of oriT [Strand]   48153..48212 [+]
Host bacterium   Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Coordinate of element   2458865..2845784

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   fixS, fixI, fixH, fixG, fixP, fixQ, fixO, fixN, nodX, nolW, nolB, nolT, nolU, nolV, nopC, nifX, nifN, nifE, nifK, nifD, nifH, nifQ, nifS, nifW, fixA, fixB, fixC, fixX, nifB, nifZ, fixU, nifA, nodE, nodF, nodD, nodH, nodJ, nodI, nodC, nodB, nodA
Anti-CRISPR   -