Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200400
Name   oriT_ICEValZJT2 in_silico
Organism   Vibrio alginolyticus strain ZJ-T
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   CP016224 (84579..84877 [-], 299 nt)
oriT length   299 nt
IRs (inverted repeats)      45..50, 52..57  (CAAACG..CGTTTG)
 7..12, 26..31  (TTTGGC..GCCAAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 299 nt

>oriT_ICEValZJT2
GCTCTGTTTGGCGGCGGATGAATGAGCCAAAAAAATTGAGACGCCAAACGTCGTTTGCATTCTGGCCTGAACTCGCCAAACGGTTTGTATCTTCATGACGATACGTCTTTTTAGGCGTTTTTAAGTGAAATCGGGCTGTATCCCTTGTCAGATATGGGATTGCGCGAGTCGATTTATATCGAGACGCCAAACAGTGATTGCTACGGCAGTTTTACGTTTGGCGTTTCGATCCAAAAGCCAAACGGATAGTGGTTTTGGCTTTTGGGGTTAATTGGATGGGGAAATTGGTTTGGTAGAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14427 GenBank   ANP64261
Name   TraI_2_BAU10_04425_ICEValZJT2 insolico UniProt ID   _
Length   716 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 716 a.a.        Molecular weight: 79794.89 Da        Isoelectric Point: 5.2898

>ANP64261.1 phosphohydrolase [Vibrio alginolyticus]
MFKNLFFQTKALPELSSQLDTEIPRYPPFLKGLPAASPEDLQSTQDELIAKLRQVLGFNQRDFQRLIQPC
IDHLAAYVHLLPASEHHHHSGAGGLLRHSLEVAFWAAQAAEGIIFVASGTPVEKKELEPRWRVAAALGGL
FHDIGKPVSDLSITDEDGRYQWNPFLETLSQWATNNRIERYFIRWRDGRCKRHEQFSILVLNRVMTPELL
AWLTQPGPEILQAMLEAIGNTDPENVLSKLVIEADQTSVQRDLKAQRISVDDNALGVPVERYLLDAMRRL
LASSQWLVNQRDARVWIRKSNQSTNLYLVWKSAAKEIIELLAKDKIPGIPRDPDTLADILIERGLATKSA
SNERYESFAPEVLIKDSKPIWLPMLHISEADLLFCSNVPSGVTLFNKSEWEATQQTQAEPQSRSSEHPDL
SEASSSIEHSNSAESPSSKSSEQDDELRHASDVSTPQATENAPGDECEKPNNSYDGAISNNVNQQDAEAL
NLPESLAWFPEASSALIMVGEQLLIRYPDAVRPWCAPRKLLAELSRLDWLELDPANPTRKARTITTKDGV
QEQGLLLKVSISKGLTALIDLSKQDAESVTAIQNKEASQRPSRINITNAQAKEPATRAERKQKPIAANAN
SSTDPKHAQRQQMVSFVKDLPILLTDGDYPDVDHSADGIRVTIQTLRQVANEHGIPAGQLLRGISASDQC
QFDEGETVLFTAHAKR

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(39-349)


  Protein structure



No available structure.




T4CP

ID   16951 GenBank   ANP64260
Name   tcpA_BAU10_04420_ICEValZJT2 insolico UniProt ID   _
Length   577 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 577 a.a.        Molecular weight: 63396.86 Da        Isoelectric Point: 7.0313

>ANP64260.1 hypothetical protein BAU10_04420 [Vibrio alginolyticus]
MERKNWFSPYDPTRRIGSVISVSATELIINLSKAGSGEPSWSFGNRIAAGEVNEFVFIDIGETAILGRLV
KVWIEGGDRLSVDGLADKPSENHPIGLVQLLVSLNPANGRNYKGIKQHPRLGSQIYSAHPYLVSIIAEGK
QDEEPGQIHLPLASLPHDESVTVHVTPEKLFSRHCAILGATGGGKSYSMTNIIEQVIKAGGKAIIIDPTG
EYESLGCDSYYVGNHAKATPFNQLTFPHWQFTDSDIRAFLRPSAQSQAPKLEAAIESQRLVSHYYQNNSF
GLGITSEYLLNKSGQLKATYKSALVQMNSHNQASPWSFALTAEQIECECVYPTANYGKDPSKWGDRSEAD
VGHCLNLISRMKAYASNTNLKWMIDAAGELKTLPDLIDEFCSSNQNNNVIRLDLSAVPFEANSREILVNA
IGRKLLSVARQGAINHGAPLLVFIDEAHQFLNKRIGEETNRFELDAFGNIAKEGRKYGLNTIIATQRPRD
IPEDVLSQIGTLIVHRLTNQLDQEIVKKAVGAIDQRSASFLPVLGQGEALLLGVDFPFPMTVKMKRPANA
PTSKSAGFSKSWNPFQN

  Protein domains


Predicted by InterproScan.

Helicase HerA, central domain (DUF87)

(155-422)

Helicase HerA-like C-terminal (HerA_C)

(440-541)

  Protein structure



No available structure.



ID   16952 GenBank   ANP64262
Name   t4cp2_BAU10_04430_ICEValZJT2 insolico UniProt ID   _
Length   606 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 606 a.a.        Molecular weight: 67086.89 Da        Isoelectric Point: 6.5728

>ANP64262.1 conjugal transfer protein [Vibrio alginolyticus]
MKENAYEMPWRTNYEAMAAAGWLVGATGAIAAEMLTELPPEPFWWMTGISSGMALYRLPEAYRLHKLQKG
LKGKPLAFMELSHLQKVMAKHPDELWLGYGFEWDQRHAQRAYEILKRDKQTLLNQGHGKQMGSTWIHGVE
PKEEDVYQPVGHTEGHTLIVGTTGAGKTRCFDAMITQAILRNEAVIIIDPKGDKELKDNAQRACIAAGSP
ERFVYFHPGFPEHSVRLNPLRNFNRGTEIASRIAALIPSETGADPFKAFGQMALNNIVQGLLLTSQRPDL
KTLRRFLEGGPEGLVVKAVTAWGEQVYPNFSVEIKRFTEKANTLAKQAMAMLLFYYERIQPVAANTDLEG
LLSMFEHDRTHYSKMVASLMPVLNMLTSSELGPLLSPIANDVDDSRLITDSGRIINNAQVAYIGLDSLTD
AMVGSAIGSLLLSDLTAVAGDRYNYGVENRPVNIFIDEAAEVVNDPFIQLLNKGRGAKMRCVIATQTFAD
FAARTGSEAKARQVLGNINNLIALRVMDAETQQYITDNLPKTRLQYIMQTQGMSSNSDSPALFTGNHGER
LMEEEGDMFPPQLLGQLPNLEYIAKLSGGRVIKGRIPILTSSTQAA

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(451-578)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(152-285)

  Protein structure



No available structure.



ID   16953 GenBank   ANP64275
Name   t4cp2_BAU10_04500_ICEValZJT2 insolico UniProt ID   _
Length   800 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 800 a.a.        Molecular weight: 90281.81 Da        Isoelectric Point: 5.8204

>ANP64275.1 type-IV secretion system protein TraC [Vibrio alginolyticus]
MKASLYSGQRASELLPVLAYSDDEQLFFMEDQSVGFGFLCDPLPGGDESVADRVNVLLNNDWPKDTLLQF
GLYASPDIQTDLQRMMGLRHRQSDPLLRASIRKRADFLDGGTVQPIEESTQTQVRNFQLIVTCKLPLESP
IPTERELSRASALRASFSQALATVGFRVTEMTDRNWLAALSAQLNWGKDASWRNPSPIRSEADKPLREQV
LDYDRAIKVDSQGLMLGDYRVKTLSFKRLPERIWFGHAASFAGDMMTGSRGLRGSFLLNVTIHFPSAESI
RSRLETKRQWAVNQAYGPMLKFVPVLAAKKKGFDVLFEALQEGDRPIRANMNLTLFSPTEEASISSVSNA
RTYFKELGFELMEDKYFCLPIFLNALPFGADRQAMNDLFRFKTMATRHVIPLLPLFADWKGTGTPVINFV
SRNGQIMSVSLYDSGSNYNCCIAAQSGSGKSFLVNEIISSYLSEGGQCWVIDVGRSYEKLCEVYDGEFLQ
FGRDSGICLNPFEIVEDYDEEADVLVGLLAAMAAPTQSLTDFQMANLKRQTRELWEKKGRAMLVDDVAEA
LKNHEDRRVQDVGEQLYPFTTQGEYGRFFNGHNNIRFKNRFTVLELEELKGRKHLQQVVLLQLIYQIQQE
MYLGERDRRKIVFIDEAWDLLTQGDVGKFIETGYRRFRKYGGSAVTVTQSVNDLYDSPTGKAIAENSANM
YLLGQKAETINALKKEGRLPLGEGGYEYLKTVHTVTGVYSEIFFITEMGTGIGRLIVDPFHKLLYSSRAE
DVNAIKQLTRKGLSVADAISQLLKERGFDE

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(436-521)

TraG P-loop domain (P-loop_TraG)

(566-794)

TraC protein (TraC_F_IV)

(11-241)

Family of unknown function (DUF5934) (DUF5934)

(253-420)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 955247..2525324

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BAU10_04410 950755..953871 + 3117 ANP64258 DEAD/DEAH box helicase -
BAU10_04415 953975..955234 + 1260 ANP64259 hypothetical protein -
BAU10_04420 955247..956980 + 1734 ANP64260 hypothetical protein virb4
BAU10_04425 957098..959248 + 2151 ANP64261 phosphohydrolase -
BAU10_04430 959296..961116 + 1821 ANP64262 conjugal transfer protein virb4
BAU10_04435 961126..961686 + 561 ANP64263 conjugative transfer protein -
BAU10_04440 961673..962308 + 636 ANP64264 conjugal transfer protein tfc7
BAU10_04445 962446..963552 + 1107 ANP64265 cell filamentation protein Fic -
BAU10_04450 963754..964044 - 291 ANP64266 addiction module antidote protein, HigA family -
BAU10_04455 964277..964558 + 282 ANP64267 type IV conjugative transfer system protein TraL traL
BAU10_04460 964555..965181 + 627 ANP64268 pilus assembly protein traE
BAU10_04465 965165..966061 + 897 ANP66442 hypothetical protein traK
BAU10_04470 966064..967353 + 1290 ANP64269 conjugal transfer protein TraB traB
BAU10_04475 967350..968000 + 651 ANP64270 conjugal transfer protein TraV traV
BAU10_04480 967997..968383 + 387 ANP64271 hypothetical protein -
BAU10_04485 968424..968930 - 507 ANP64272 GCN5 family acetyltransferase -
BAU10_04490 968921..969187 - 267 ANP64273 hypothetical protein -
BAU10_04495 969556..970248 + 693 ANP64274 disulfide isomerase trbB
BAU10_04500 970249..972651 + 2403 ANP64275 type-IV secretion system protein TraC virb4
BAU10_04505 972644..972991 + 348 ANP64276 plasmid-related protein -
BAU10_04510 973068..973487 + 420 ANP66443 S26 family signal peptidase -
BAU10_04515 973498..974622 + 1125 ANP64277 pilus assembly protein traW
BAU10_04520 974606..975634 + 1029 ANP64278 conjugal transfer protein TraU traU
BAU10_04525 975637..979329 + 3693 ANP64279 conjugal transfer protein TraN traN
BAU10_04530 979560..979892 + 333 ANP64280 hypothetical protein -
BAU10_04535 979923..980612 + 690 ANP64281 hypothetical protein -
BAU10_04540 980590..980856 - 267 ANP64282 transposase -
BAU10_04545 980982..981356 + 375 ANP64283 hypothetical protein -
BAU10_04550 981402..982151 - 750 Protein_872 transposase -
BAU10_04555 982638..982835 - 198 ANP64284 hypothetical protein -
BAU10_04560 983143..984786 + 1644 ANP64285 BCCT transporter -
BAU10_04565 984982..985839 - 858 ANP64286 mechanosensitive ion channel protein -
BAU10_04570 985917..986387 - 471 ANP64287 calcium:sodium antiporter -
BAU10_04575 986443..987378 + 936 Protein_877 transposase -
BAU10_04580 987992..989296 + 1305 ANP64288 group II intron reverse transcriptase/maturase -
BAU10_04585 989395..990183 - 789 Protein_879 DDE endonuclease -
BAU10_04590 990311..991642 - 1332 ANP64289 transposase -
BAU10_04595 991770..992372 - 603 ANP64290 hypothetical protein -
BAU10_04600 992740..993066 + 327 ANP64291 plasmid-related protein -
BAU10_04605 993082..993501 + 420 ANP64292 single-stranded DNA-binding protein -
BAU10_04610 993581..994399 + 819 ANP64293 phage recombination protein Bet -
BAU10_04615 994686..995702 + 1017 ANP64294 endonuclease -
BAU10_04620 995912..996871 + 960 ANP64295 ATPase -
BAU10_04625 996871..997638 + 768 ANP64296 hypothetical protein -
BAU10_04630 997737..998690 + 954 ANP64297 cobalamin biosynthesis protein -
BAU10_04635 998752..999192 + 441 ANP64298 hypothetical protein -
BAU10_04640 999262..1000917 + 1656 ANP64299 hypothetical protein -
BAU10_04645 1001001..1001498 + 498 ANP64300 DNA repair protein RadC -
BAU10_04650 1001498..1001839 + 342 ANP64301 plasmid-related protein -
BAU10_04655 1001930..1003003 + 1074 ANP64302 DNA primase -
BAU10_04660 1003092..1003799 + 708 ANP64303 hypothetical protein -
BAU10_04665 1003956..1004288 + 333 ANP64304 hypothetical protein -
BAU10_04670 1004385..1005737 - 1353 ANP64305 hypothetical protein -
BAU10_04675 1006253..1007047 + 795 ANP64306 hypothetical protein -
BAU10_04680 1007218..1007691 - 474 Protein_898 hypothetical protein -
BAU10_04685 1007805..1008236 - 432 ANP64307 hypothetical protein -
BAU10_04690 1008233..1008706 - 474 ANP64308 hypothetical protein -
BAU10_04695 1008852..1009031 + 180 ANP64309 transcriptional regulator -
BAU10_04700 1009208..1009477 + 270 ANP64310 hypothetical protein -
BAU10_04705 1009558..1010238 - 681 ANP64311 two-component response regulator DpiA -
BAU10_04710 1010225..1011880 - 1656 ANP64312 ATPase -
BAU10_04715 1011993..1013294 - 1302 ANP64313 oxaloacetate decarboxylase subunit beta -
BAU10_04720 1013310..1015121 - 1812 ANP64314 oxaloacetate decarboxylase subunit alpha -
BAU10_04725 1015133..1015384 - 252 ANP64315 oxaloacetate decarboxylase -
BAU10_04730 1015453..1016796 - 1344 ANP66444 citrate:sodium symporter -
BAU10_04735 1017067..1018119 + 1053 ANP66445 [citrate (pro-3S)-lyase] ligase -
BAU10_04740 1018161..1018457 + 297 ANP64316 citrate lyase acyl carrier protein -
BAU10_04745 1018454..1019329 + 876 ANP64317 citrate (pro-3S)-lyase subunit beta -
BAU10_04750 1019384..1020856 + 1473 ANP66446 citrate lyase subunit alpha -
BAU10_04755 1020853..1021389 + 537 ANP64318 holo-ACP synthase CitX -
BAU10_04760 1021370..1022329 + 960 ANP64319 triphosphoribosyl-dephospho-CoA synthase CitG -
BAU10_04765 1022348..1023175 + 828 ANP64320 hypothetical protein -
BAU10_04770 1023592..1025205 + 1614 Protein_916 transposase -
BAU10_04775 1025226..1025738 - 513 Protein_917 transposase -
BAU10_04780 1026108..1027052 + 945 ANP64321 pilus assembly protein -
BAU10_04785 1027055..1028443 + 1389 ANP64322 conjugal transfer protein TraH -
BAU10_04790 1028447..1032016 + 3570 ANP64323 conjugal transfer protein TraG -
BAU10_04795 1032049..1032480 - 432 ANP64324 hypothetical protein -
BAU10_04800 1032538..1033071 - 534 ANP64325 transcriptional regulator -
BAU10_04805 1033068..1033367 - 300 ANP64326 transcriptional regulator -
BAU10_04810 1033364..1033912 - 549 ANP64327 transglycosylase -
BAU10_04815 1033899..1034561 - 663 ANP64328 hypothetical protein -
BAU10_04820 1034548..1035417 - 870 ANP64329 hypothetical protein -
BAU10_04825 1035473..1035724 - 252 ANP64330 Cro/Cl family transcriptional regulator -
BAU10_04830 1035842..1036489 + 648 ANP64331 transcriptional regulator -
BAU10_04835 1037396..1038388 - 993 ANP64332 cytochrome BD ubiquinol oxidase subunit II -
BAU10_04840 1038391..1039722 - 1332 ANP64333 cytochrome D ubiquinol oxidase subunit I -
BAU10_04845 1040538..1040786 + 249 ANP64334 hypothetical protein -
BAU10_04850 1040792..1041781 - 990 ANP64335 hypothetical protein -
BAU10_04855 1042556..1044193 + 1638 ANP64336 chemotaxis protein -
BAU10_04860 1044659..1045798 + 1140 ANP64337 efflux transporter periplasmic adaptor subunit -
BAU10_04865 1045801..1048962 + 3162 ANP64338 multidrug efflux RND transporter permease -
BAU10_04870 1049150..1049605 + 456 ANP64339 transcriptional regulator -
BAU10_04875 1049650..1050606 - 957 ANP64340 transporter -
BAU10_04880 1051208..1052230 + 1023 ANP64341 tryptophan--tRNA ligase -
BAU10_04885 1052315..1053271 - 957 ANP64342 ATP-dependent dsDNA exonuclease -
BAU10_04890 1053268..1054596 - 1329 ANP64343 phospholipase -
BAU10_04895 1054888..1055154 + 267 ANP64344 hypothetical protein -
BAU10_04900 1055309..1056937 + 1629 ANP64345 chemotaxis protein -
BAU10_04905 1057063..1057833 - 771 ANP64346 tRNA hydroxylase -
BAU10_04910 1057931..1058695 - 765 ANP64347 DNA repair protein -
BAU10_04915 1059009..1059983 + 975 ANP64348 transcriptional regulator CysB -
BAU10_04920 1060037..1061233 + 1197 ANP64349 SAM-dependent methyltransferase -
BAU10_04925 1061327..1062451 - 1125 ANP64350 alanine dehydrogenase -
BAU10_04930 1062608..1063102 + 495 ANP64351 leucine-responsive transcriptional regulator -
BAU10_04935 1063255..1066302 + 3048 ANP64352 cell division protein FtsK -
BAU10_04940 1066364..1066990 + 627 ANP64353 outer membrane lipoprotein carrier protein LolA -
BAU10_04945 1066997..1068346 + 1350 ANP66447 recombination factor protein RarA -
BAU10_04950 1068438..1069745 + 1308 ANP64354 serine--tRNA ligase -
BAU10_04955 1069942..1070208 + 267 ANP64355 hypothetical protein -
BAU10_04960 1070278..1071558 - 1281 ANP64356 adenosylmethionine--8-amino-7-oxononanoate transaminase -
BAU10_04965 1071689..1072741 + 1053 ANP64357 biotin synthase BioB -
BAU10_04970 1072728..1073879 + 1152 ANP64358 8-amino-7-oxononanoate synthase -
BAU10_04975 1073879..1074700 + 822 ANP64359 malonyl-[acyl-carrier protein] O-methyltransferase BioC -
BAU10_04980 1074697..1075383 + 687 ANP64360 dethiobiotin synthase -
BAU10_04985 1076142..1077011 + 870 ANP64361 zinc metalloprotease HtpX -
BAU10_04990 1077221..1077640 + 420 ANP64362 transcriptional regulator -
BAU10_04995 1077637..1078362 + 726 ANP64363 short-chain dehydrogenase -
BAU10_05000 1078375..1079685 + 1311 ANP64364 FAD-dependent oxidoreductase -
BAU10_05005 1079687..1080505 + 819 ANP64365 chromosome partitioning protein ParA -
BAU10_05010 1080499..1081755 + 1257 ANP64366 cyclopropane-fatty-acyl-phospholipid synthase -
BAU10_05015 1081762..1082274 + 513 ANP64367 zinc ABC transporter permease -
BAU10_05020 1082234..1082827 + 594 ANP64368 hypothetical protein -
BAU10_05025 1082839..1083360 + 522 ANP66448 hypothetical protein -
BAU10_05030 1083494..1084864 - 1371 ANP64369 adenylosuccinate lyase -
BAU10_05035 1085018..1085635 - 618 ANP64370 lysogenization protein HflD -
BAU10_05040 1085646..1086770 - 1125 ANP64371 tRNA 2-thiouridine(34) synthase MnmA -
BAU10_05045 1086959..1087228 + 270 ANP64372 hypothetical protein -
BAU10_05050 1087346..1088650 + 1305 ANP64373 inosine/guanosine kinase -
BAU10_05055 1088778..1089185 - 408 ANP64374 transcriptional regulator -
BAU10_05060 1090060..1091661 + 1602 ANP64375 Na+/H+ antiporter -
BAU10_05065 1091663..1091854 - 192 ANP64376 hypothetical protein -
BAU10_05070 1092033..1092929 + 897 ANP64377 ATP phosphoribosyltransferase -
BAU10_05075 1092935..1094227 + 1293 ANP64378 histidinol dehydrogenase -
BAU10_05080 1094246..1095286 + 1041 ANP64379 histidinol-phosphate transaminase -
BAU10_05085 1095356..1096429 + 1074 ANP64380 bifunctional imidazole glycerol-phosphate dehydratase/histidinol phosphatase -
BAU10_05090 1096456..1097070 + 615 ANP64381 imidazole glycerol phosphate synthase, glutamine amidotransferase subunit -
BAU10_05095 1097083..1097820 + 738 ANP64382 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
BAU10_05100 1097802..1098575 + 774 ANP64383 imidazole glycerol phosphate synthase subunit HisF -
BAU10_05105 1098572..1099207 + 636 ANP64384 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase -
BAU10_05110 1099488..1100003 - 516 ANP64385 hypothetical protein -
BAU10_05115 1100084..1101298 - 1215 ANP64386 histidine kinase -
BAU10_05120 1101397..1102134 - 738 ANP64387 UDP-2,3-diacylglucosamine diphosphatase -
BAU10_05125 1102195..1102689 - 495 ANP64388 peptidylprolyl isomerase -
BAU10_05130 1102892..1104274 + 1383 ANP64389 cysteine--tRNA ligase -
BAU10_05135 1104362..1104940 + 579 ANP64390 thymidine kinase -
BAU10_05140 1105001..1105639 - 639 ANP64391 hypothetical protein -
BAU10_05145 1105636..1106463 - 828 ANP64392 NAD(P)-dependent oxidoreductase -
BAU10_05150 1106482..1107360 - 879 ANP64393 LysR family transcriptional regulator -
BAU10_05155 1107450..1107896 + 447 ANP64394 hypothetical protein -
BAU10_05160 1107940..1108173 - 234 ANP64395 TIGR02647 family protein -
BAU10_05165 1108473..1109333 + 861 ANP64396 formate transporter FocA -
BAU10_05170 1109911..1110723 - 813 ANP64397 ABC transporter permease -
BAU10_05175 1111141..1111425 - 285 ANP64398 hypothetical protein -
BAU10_05180 1111416..1112600 + 1185 ANP64399 nitrate reductase -
BAU10_05185 1112627..1115089 + 2463 ANP64400 trimethylamine N-oxide reductase I catalytic subunit -
BAU10_05190 1115288..1117027 + 1740 ANP64401 alpha-galactosidase -
BAU10_05195 1117106..1118320 - 1215 ANP64402 hypothetical protein -
BAU10_05200 1118507..1119412 + 906 ANP64403 manganese-dependent inorganic pyrophosphatase -
BAU10_05205 1119481..1119870 + 390 ANP64404 hypothetical protein -
BAU10_05210 1119952..1120743 - 792 ANP64405 peptide ABC transporter ATP-binding protein -
BAU10_05215 1120740..1121735 - 996 ANP64406 peptide ABC transporter ATP-binding protein -
BAU10_05220 1121735..1122622 - 888 ANP64407 peptide ABC transporter permease -
BAU10_05225 1122609..1123571 - 963 ANP64408 peptide ABC transporter permease -
BAU10_05230 1123571..1125190 - 1620 ANP64409 ABC transporter substrate-binding protein -
BAU10_05235 1125396..1126403 - 1008 ANP64410 phage shock protein operon transcriptional activator -
BAU10_05240 1126636..1127307 + 672 ANP64411 phage shock protein PspA -
BAU10_05245 1127322..1127555 + 234 ANP64412 phage shock protein B -
BAU10_05250 1127548..1127937 + 390 ANP64413 phage shock protein C -
BAU10_05255 1128099..1129130 + 1032 ANP64414 efflux transporter periplasmic adaptor subunit -
BAU10_05260 1129132..1130229 + 1098 ANP64415 efflux transporter periplasmic adaptor subunit -
BAU10_05265 1130226..1133336 + 3111 ANP64416 multidrug transporter AcrB -
BAU10_05270 1133409..1133975 + 567 ANP64417 DNA-3-methyladenine glycosidase -
BAU10_05275 1134000..1134860 - 861 ANP64418 lipase chaperone -
BAU10_05280 1134873..1135778 - 906 ANP64419 lipase -
BAU10_05285 1136027..1137232 - 1206 ANP64420 cystathionine beta-lyase -
BAU10_05290 1137444..1138898 - 1455 ANP64421 cardiolipin synthase -
BAU10_05295 1139329..1140699 + 1371 ANP66449 Na+-dependent transporter -
BAU10_05300 1140782..1141474 + 693 ANP64422 RNA pseudouridine synthase -
BAU10_05305 1141506..1142447 + 942 ANP64423 methyltransferase -
BAU10_05310 1142661..1143716 - 1056 ANP64424 hybrid-cluster NAD(P)-dependent oxidoreductase -
BAU10_05315 1143798..1145459 - 1662 ANP64425 hydroxylamine reductase -
BAU10_05320 1145634..1147163 - 1530 ANP64426 nitric oxide reductase transcription regulator -
BAU10_05325 1147366..1147845 - 480 ANP64427 hypothetical protein -
BAU10_05330 1147969..1148580 - 612 ANP64428 hypothetical protein -
BAU10_05335 1148573..1149220 - 648 ANP64429 ABC transporter ATP-binding protein -
BAU10_05340 1149186..1150895 - 1710 ANP64430 thiamine ABC transporter permease -
BAU10_05345 1150905..1152065 - 1161 ANP64431 hypothetical protein -
BAU10_05350 1152501..1152947 - 447 ANP64432 heat-shock protein HslJ -
BAU10_05355 1153132..1153380 + 249 ANP64433 Fe-S protein -
BAU10_05360 1153516..1153737 - 222 ANP64434 hypothetical protein -
BAU10_05365 1154153..1155841 - 1689 ANP64435 bifunctional UDP-sugar hydrolase/5'-nucleotidase -
BAU10_05370 1156594..1157109 + 516 ANP64436 GNAT family N-acetyltransferase -
BAU10_05375 1157257..1157535 - 279 ANP64437 50S ribosomal protein L25 -
BAU10_05380 1157819..1159168 - 1350 ANP64438 histidine kinase -
BAU10_05385 1159158..1159817 - 660 ANP64439 DNA-binding response regulator -
BAU10_05390 1159894..1160319 - 426 ANP64440 hypothetical protein -
BAU10_05395 1160415..1162166 - 1752 ANP64441 ATP-dependent helicase -
BAU10_05400 1162288..1162989 + 702 ANP64442 16S rRNA pseudouridine(516) synthase -
BAU10_05405 1163109..1163390 - 282 ANP64443 hypothetical protein -
BAU10_05410 1163426..1164628 + 1203 ANP64444 Bcr/CflA family drug resistance efflux transporter -
BAU10_05415 1164628..1165290 + 663 ANP64445 alpha-acetolactate decarboxylase -
BAU10_05420 1165321..1166772 - 1452 ANP64446 NAD(P)-dependent oxidoreductase -
BAU10_05425 1166867..1168243 + 1377 ANP64447 MATE family efflux transporter -
BAU10_05430 1168431..1169102 + 672 ANP64448 ABC transporter ATP-binding protein -
BAU10_05435 1169083..1171536 + 2454 ANP64449 ABC transporter permease -
BAU10_05440 1171536..1172660 + 1125 ANP64450 ABC transporter -
BAU10_05445 1172991..1174142 + 1152 ANP64451 Na(+)/H(+) antiporter NhaA -
BAU10_05450 1174860..1175495 + 636 ANP64452 TetR family transcriptional regulator -
BAU10_05455 1175567..1177849 + 2283 ANP64453 acyl-CoA dehydrogenase -
BAU10_05460 1178024..1179226 + 1203 ANP64454 trans-2-enoyl-CoA reductase -
BAU10_05465 1179305..1180987 - 1683 ANP64455 transporter -
BAU10_05470 1181163..1181429 - 267 ANP64456 glutaredoxin -
BAU10_05475 1181807..1183051 + 1245 ANP64457 alcohol dehydrogenase -
BAU10_05480 1183128..1183982 - 855 ANP64458 transcriptional regulator HexR -
BAU10_05485 1184294..1185940 - 1647 ANP64459 glutamate decarboxylase -
BAU10_05490 1186152..1186664 - 513 ANP64460 hypothetical protein -
BAU10_05495 1186873..1187778 - 906 ANP64461 hypothetical protein -
BAU10_05500 1187925..1188845 - 921 ANP64462 histidine kinase -
BAU10_05505 1189215..1189802 + 588 ANP64463 DNA transformation protein -
BAU10_05510 1189995..1190543 - 549 ANP64464 hypothetical protein -
BAU10_05515 1190835..1191332 - 498 ANP64465 hypothetical protein -
BAU10_05520 1191329..1193269 - 1941 ANP66450 ATPase -
BAU10_05525 1193456..1194724 + 1269 ANP64466 hypothetical protein -
BAU10_05530 1194862..1195956 + 1095 ANP64467 phosphoserine transaminase -
BAU10_05535 1196047..1197378 + 1332 ANP64468 D-serine ammonia-lyase -
BAU10_05540 1197477..1199198 - 1722 ANP64469 cysteine/glutathione ABC transporter ATP-binding protein/permease CydC -
BAU10_05545 1199191..1200978 - 1788 ANP64470 thiol reductant ABC exporter subunit CydD -
BAU10_05550 1201082..1202041 - 960 ANP64471 thioredoxin-disulfide reductase -
BAU10_05555 1202401..1203057 + 657 ANP64472 agglutination protein -
BAU10_05560 1203041..1204276 + 1236 ANP64473 cysteine desulfurase-like protein -
BAU10_05565 1204367..1205203 - 837 ANP64474 hypothetical protein -
BAU10_05570 1205540..1206877 + 1338 ANP66451 diguanylate cyclase -
BAU10_05575 1207021..1208391 - 1371 ANP64475 Anion transporter -
BAU10_05580 1208611..1209345 - 735 ANP64476 SanA protein -
BAU10_05585 1209500..1211188 - 1689 ANP64477 NAD-dependent malic enzyme -
BAU10_05590 1211402..1213756 + 2355 ANP66452 DEAD/DEAH box helicase -
BAU10_05595 1214045..1214422 + 378 ANP64478 transporter -
BAU10_05600 1214752..1216425 + 1674 ANP64479 alkaline phosphatase -
BAU10_05605 1216504..1217607 - 1104 ANP64480 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
BAU10_05610 1217811..1218203 - 393 ANP64481 hypothetical protein -
BAU10_05615 1218615..1218797 - 183 ANP64482 hypothetical protein -
BAU10_05620 1218975..1219949 - 975 ANP64483 molecular chaperone DnaJ -
BAU10_05625 1220026..1220694 - 669 ANP64484 hypothetical protein -
BAU10_05630 1220903..1221598 - 696 ANP64485 transcriptional regulator -
BAU10_05635 1221807..1222487 - 681 ANP64486 chemotaxis protein CheX -
BAU10_05640 1222749..1225784 + 3036 ANP64487 hypothetical protein -
BAU10_05645 1225858..1226319 + 462 ANP64488 hypothetical protein -
BAU10_05650 1226430..1227155 - 726 ANP64489 hypothetical protein -
BAU10_05655 1227491..1229026 - 1536 ANP64490 histidine ammonia-lyase -
BAU10_05660 1229038..1230735 - 1698 ANP66453 urocanate hydratase -
BAU10_05665 1230809..1231819 - 1011 ANP64491 formimidoylglutamase -
BAU10_05670 1231821..1233071 - 1251 ANP64492 imidazolonepropionase -
BAU10_05675 1233201..1233908 - 708 ANP64493 histidine utilization repressor -
BAU10_05680 1234157..1234900 + 744 ANP64494 sporulation control protein Spo0M -
BAU10_05685 1234907..1235884 - 978 ANP64495 hypothetical protein -
BAU10_05690 1236288..1238216 + 1929 ANP64496 threonine--tRNA ligase -
BAU10_05695 1238382..1238771 + 390 ANP64497 translation initiation factor IF-3 -
BAU10_05700 1238893..1239087 + 195 ANP64498 50S ribosomal protein L35 -
BAU10_05705 1239128..1239481 + 354 ANP64499 50S ribosomal protein L20 -
BAU10_05710 1239671..1239988 + 318 ANP64500 hypothetical protein -
BAU10_05715 1240355..1241164 + 810 ANP64501 hypothetical protein -
BAU10_05720 1241157..1241342 - 186 ANP64502 hypothetical protein -
BAU10_05725 1241613..1242401 + 789 ANP64503 TetR family transcriptional regulator -
BAU10_05730 1242651..1245029 + 2379 ANP64504 RND transporter -
BAU10_05735 1245048..1245839 + 792 ANP64505 outer membrane lipoprotein-sorting protein -
BAU10_05740 1245850..1247025 + 1176 ANP64506 hypothetical protein -
BAU10_05745 1247217..1248200 + 984 ANP64507 phenylalanine--tRNA ligase subunit alpha -
BAU10_05750 1248219..1250624 + 2406 ANP64508 phenylalanine--tRNA ligase subunit beta -
BAU10_05755 1250838..1251719 - 882 ANP64509 hypothetical protein -
BAU10_05760 1252254..1252550 + 297 ANP64510 integration host factor subunit alpha -
BAU10_05765 1252672..1253451 - 780 ANP64511 phosphoribosylglycinamide formyltransferase -
BAU10_05770 1253767..1254417 + 651 ANP66454 thiopurine S-methyltransferase -
BAU10_05775 1254490..1255665 - 1176 ANP64512 phosphoribosylglycinamide formyltransferase 2 -
BAU10_05780 1255809..1256696 - 888 ANP64513 cytidine deaminase -
BAU10_05785 1257128..1257805 - 678 ANP64514 CidB/LrgB family autolysis modulator -
BAU10_05790 1257807..1258181 - 375 ANP64515 hypothetical protein -
BAU10_05795 1258237..1259658 - 1422 ANP64516 exodeoxyribonuclease I -
BAU10_05800 1259816..1261189 - 1374 ANP64517 L-cystine transporter tcyP -
BAU10_05805 1261390..1262079 - 690 ANP64518 nucleoside-diphosphate sugar epimerase -
BAU10_05810 1262329..1263372 + 1044 ANP64519 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase -
BAU10_05815 1263372..1264178 + 807 ANP64520 adenosylcobinamide-GDP ribazoletransferase -
BAU10_05820 1264175..1264708 + 534 ANP64521 bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase -
BAU10_05825 1264720..1265334 + 615 ANP64522 alpha-ribazole phosphatase -
BAU10_05830 1265463..1267259 + 1797 ANP64523 oligoendopeptidase F -
BAU10_05835 1267534..1268565 + 1032 ANP64524 succinylglutamate desuccinylase -
BAU10_05840 1268648..1269643 + 996 ANP64525 vitamin B12 ABC transporter permease BtuC -
BAU10_05845 1269633..1270397 + 765 ANP64526 vitamin B12 ABC transporter ATP-binding protein BtuD -
BAU10_05850 1270467..1271042 - 576 ANP64527 SAM-dependent methyltransferase -
BAU10_05855 1271152..1271724 - 573 ANP64528 hypothetical protein -
BAU10_05860 1271815..1273038 - 1224 ANP64529 MFS transporter permease -
BAU10_05865 1273145..1274014 + 870 ANP64530 LysR family transcriptional regulator -
BAU10_05870 1274042..1274272 - 231 ANP64531 NrdH-redoxin -
BAU10_05875 1274411..1274926 + 516 ANP64532 metal-dependent hydrolase -
BAU10_05880 1274913..1276040 + 1128 ANP64533 23S rRNA (adenine(1618)-N(6))-methyltransferase -
BAU10_05885 1276113..1276493 - 381 ANP66455 hypothetical protein -
BAU10_05890 1276504..1278099 - 1596 ANP64534 peptidase S41 -
BAU10_05895 1278458..1279222 - 765 ANP64535 transcriptional regulator -
BAU10_05900 1279253..1279927 - 675 ANP64536 GntR family transcriptional regulator -
BAU10_05905 1280080..1281612 - 1533 ANP64537 aldehyde dehydrogenase -
BAU10_05910 1281634..1282635 - 1002 ANP64538 hydroxyproline-2-epimerase -
BAU10_05915 1282745..1284001 + 1257 ANP64539 amino acid dehydrogenase -
BAU10_05920 1284125..1285198 + 1074 ANP64540 spermidine/putrescine ABC transporter substrate-binding protein -
BAU10_05925 1285285..1286259 + 975 ANP64541 ornithine cyclodeaminase -
BAU10_05930 1286316..1287230 + 915 ANP64542 dihydrodipicolinate synthase family protein -
BAU10_05935 1287304..1288425 + 1122 ANP64543 spermidine/putrescine ABC transporter ATP-binding protein -
BAU10_05940 1288422..1289702 + 1281 ANP64544 ABC transporter permease -
BAU10_05945 1289705..1290553 + 849 ANP64545 polyamine ABC transporter permease -
BAU10_05950 1290674..1291108 - 435 ANP64546 hypothetical protein -
BAU10_05955 1291411..1293855 + 2445 ANP64547 collagenase -
BAU10_05960 1294016..1295812 - 1797 ANP64548 Xaa-Pro aminopeptidase -
BAU10_05965 1295812..1296804 - 993 ANP64549 oligopeptide ABC transporter ATP-binding protein OppF -
BAU10_05970 1296814..1297797 - 984 ANP64550 oligopeptide transporter ATP-binding component -
BAU10_05975 1297808..1298740 - 933 ANP64551 peptide ABC transporter permease -
BAU10_05980 1298750..1299670 - 921 ANP64552 oligopeptide transporter permease -
BAU10_05985 1299815..1301425 - 1611 ANP64553 peptide ABC transporter substrate-binding protein -
BAU10_05990 1301690..1302796 - 1107 ANP64554 peptidase M20 -
BAU10_05995 1303335..1304408 + 1074 ANP64555 4-hydroxyphenylpyruvate dioxygenase -
BAU10_06000 1304401..1305531 + 1131 ANP64556 homogentisate 1,2-dioxygenase -
BAU10_06005 1305541..1306578 + 1038 ANP64557 2-keto-4-pentenoate hydratase -
BAU10_06010 1306600..1307268 + 669 ANP64558 maleylacetoacetate isomerase -
BAU10_06015 1307464..1308123 + 660 ANP64559 hypothetical protein -
BAU10_06020 1308243..1308581 + 339 ANP64560 hypothetical protein -
BAU10_06035 1309206..1309445 - 240 ANP64561 hypothetical protein -
BAU10_06040 1309566..1310204 - 639 ANP64562 thiamine biosynthesis protein ThiJ -
BAU10_06045 1310370..1310768 - 399 ANP64563 glyoxalase -
BAU10_06050 1310974..1311612 - 639 ANP64564 hypothetical protein -
BAU10_06055 1311739..1312188 - 450 ANP64565 hypothetical protein -
BAU10_06060 1312352..1312741 - 390 ANP64566 hypothetical protein -
BAU10_06065 1313146..1313397 - 252 ANP64567 TIGR03643 family protein -
BAU10_06070 1313496..1313996 - 501 ANP64568 histone acetyltransferase -
BAU10_06075 1314147..1314527 - 381 ANP64569 hypothetical protein -
BAU10_06080 1314681..1315085 - 405 ANP64570 hypothetical protein -
BAU10_06085 1315227..1315559 - 333 ANP64571 hypothetical protein -
BAU10_06090 1315624..1316091 - 468 ANP64572 hypothetical protein -
BAU10_06095 1316508..1317191 - 684 ANP64573 hypothetical protein -
BAU10_06100 1317441..1318916 - 1476 ANP64574 sodium:proton antiporter -
BAU10_06105 1318935..1320278 - 1344 ANP64575 gamma-glutamylputrescine synthetase -
BAU10_06110 1320619..1321365 + 747 ANP64576 gamma-glutamyl-gamma-aminobutyrate hydrolase -
BAU10_06115 1321384..1321941 + 558 ANP64577 XRE family transcriptional regulator -
BAU10_06120 1321977..1323461 + 1485 ANP64578 aldehyde dehydrogenase PuuC -
BAU10_06125 1323499..1324776 + 1278 ANP64579 gamma-glutamylputrescine oxidoreductase -
BAU10_06130 1324794..1325660 + 867 ANP64580 N-carbamoylputrescine amidase -
BAU10_06135 1325673..1326755 + 1083 ANP64581 agmatine deiminase -
BAU10_06140 1326810..1328237 + 1428 ANP64582 succinate-semialdehyde dehydrogenase (NADP(+)) -
BAU10_06145 1328252..1329523 + 1272 ANP64583 4-aminobutyrate transaminase -
BAU10_06150 1329870..1331366 + 1497 ANP64584 diguanylate phosphodiesterase -
BAU10_06155 1331498..1332385 - 888 ANP64585 multidrug transporter -
BAU10_06160 1332496..1332978 + 483 ANP64586 transcriptional regulator -
BAU10_06165 1333002..1333355 + 354 ANP64587 hypothetical protein -
BAU10_06170 1333475..1333909 + 435 ANP64588 hypothetical protein -
BAU10_06175 1334112..1334423 + 312 ANP64589 hypothetical protein -
BAU10_06180 1334570..1335661 - 1092 ANP64590 sulfate ABC transporter permease -
BAU10_06185 1335663..1336139 - 477 ANP64591 hypothetical protein -
BAU10_06190 1336149..1339319 - 3171 ANP66456 hybrid sensor histidine kinase/response regulator -
BAU10_06195 1339482..1341638 - 2157 ANP64592 diguanylate phosphodiesterase -
BAU10_06200 1341638..1342567 - 930 ANP64593 alkylphosphonate ABC transporter -
BAU10_06205 1342835..1343560 - 726 ANP64594 type IV pilus biogenesis/stability protein PilW -
BAU10_06210 1343740..1344681 - 942 ANP64595 homoserine O-succinyltransferase -
BAU10_06215 1345022..1345408 + 387 ANP64596 hypothetical protein -
BAU10_06220 1345511..1345867 + 357 ANP64597 ethidium bromide resistance protein -
BAU10_06225 1346288..1347238 + 951 ANP66457 lipid A biosynthesis lauroyl acyltransferase -
BAU10_06230 1347308..1347523 - 216 ANP64598 hypothetical protein -
BAU10_06235 1347623..1348369 + 747 ANP64599 hypothetical protein -
BAU10_06240 1348543..1348764 + 222 ANP64600 hypothetical protein -
BAU10_06245 1348752..1349249 + 498 ANP64601 hypothetical protein -
BAU10_06250 1349328..1351637 - 2310 ANP64602 hypothetical protein -
BAU10_06255 1352885..1353889 + 1005 ANP64603 hypothetical protein -
BAU10_06260 1353902..1354753 + 852 ANP64604 hypothetical protein -
BAU10_06265 1354812..1357433 + 2622 ANP64605 hypothetical protein -
BAU10_06270 1357434..1357916 - 483 ANP64606 hypothetical protein -
BAU10_06275 1357909..1358340 - 432 ANP64607 hypothetical protein -
BAU10_06280 1358925..1359536 + 612 ANP64608 hypothetical protein -
BAU10_06285 1359705..1360034 + 330 ANP64609 hypothetical protein -
BAU10_06290 1360105..1361433 - 1329 ANP64610 AAA family ATPase -
BAU10_06295 1361672..1361962 + 291 ANP64611 hypothetical protein -
BAU10_06300 1362159..1362671 - 513 ANP64612 hypothetical protein -
BAU10_06305 1363223..1366066 - 2844 ANP64613 hypothetical protein -
BAU10_06310 1366059..1367465 - 1407 ANP64614 hypothetical protein -
BAU10_06315 1367465..1368250 - 786 ANP64615 hypothetical protein -
BAU10_06320 1368262..1370076 - 1815 ANP64616 hypothetical protein -
BAU10_06325 1370278..1370502 + 225 ANP64617 hypothetical protein -
BAU10_06330 1370553..1371173 + 621 ANP64618 hypothetical protein -
BAU10_06335 1371315..1372028 - 714 ANP64619 hypothetical protein -
BAU10_06340 1372328..1373119 - 792 ANP64620 metal-dependent hydrolase -
BAU10_06345 1373119..1376385 - 3267 ANP64621 DEAD/DEAH box helicase -
BAU10_06350 1376436..1377293 - 858 ANP64622 hypothetical protein -
BAU10_06355 1377373..1378689 - 1317 ANP64623 hypothetical protein -
BAU10_06360 1378679..1380196 - 1518 ANP64624 type I restriction-modification system subunit M -
BAU10_06365 1380213..1380839 - 627 ANP64625 hypothetical protein -
BAU10_06370 1381065..1382819 + 1755 ANP64626 hypothetical protein -
BAU10_06375 1382803..1383012 + 210 ANP64627 ATPase -
BAU10_06380 1383489..1383887 + 399 ANP64628 hypothetical protein -
BAU10_06385 1383971..1384609 + 639 Protein_1237 hypothetical protein -
BAU10_06390 1384696..1385133 + 438 ANP64629 AAA family ATPase -
BAU10_06395 1385142..1385408 + 267 ANP64630 hypothetical protein -
BAU10_06400 1385463..1385753 + 291 ANP64631 hypothetical protein -
BAU10_06405 1385994..1386728 + 735 ANP64632 hypothetical protein -
BAU10_06410 1386935..1388776 - 1842 ANP64633 hypothetical protein -
BAU10_06415 1389054..1390313 - 1260 ANP64634 XRE family transcriptional regulator -
BAU10_06420 1390313..1390720 - 408 ANP64635 DNA polymerase V -
BAU10_06425 1391142..1391372 + 231 ANP66458 hypothetical protein -
BAU10_06430 1391587..1392966 - 1380 ANP64636 hypothetical protein -
BAU10_06435 1393469..1394311 - 843 ANP64637 hypothetical protein -
BAU10_06440 1394570..1396198 - 1629 ANP64638 hypothetical protein -
BAU10_06445 1396291..1396938 - 648 ANP64639 hypothetical protein -
BAU10_06450 1397761..1398729 + 969 ANP64640 hypothetical protein -
BAU10_06455 1398863..1400410 - 1548 ANP64641 peptidase M32 -
BAU10_06460 1400634..1401269 + 636 ANP66459 threonine transporter RhtB -
BAU10_06465 1401269..1401835 + 567 ANP64642 threonine transporter RhtB -
BAU10_06470 1401954..1403330 - 1377 ANP64643 sodium:alanine symporter -
BAU10_06475 1404270..1405004 + 735 ANP64644 chromosome partitioning protein ParA -
BAU10_06480 1405094..1405477 - 384 ANP64645 hypothetical protein -
BAU10_06485 1405577..1405942 - 366 ANP64646 glyoxalase -
BAU10_06490 1406089..1408038 - 1950 ANP64647 hypothetical protein -
BAU10_06495 1408233..1409240 - 1008 ANP64648 glycine betaine ABC transporter substrate-binding protein -
BAU10_06500 1409233..1410318 - 1086 ANP64649 glycine/betaine ABC transporter permease -
BAU10_06505 1410323..1411510 - 1188 ANP64650 glycine betaine/L-proline ABC transporter ATP-binding protein -
BAU10_06510 1411949..1413829 + 1881 ANP64651 cyclic nucleotide-binding protein -
BAU10_06515 1413826..1414575 + 750 ANP64652 DNA polymerase III subunit epsilon -
BAU10_06520 1414769..1416427 + 1659 ANP64653 BCCT transporter -
BAU10_06525 1416742..1417275 + 534 ANP64654 diaminobutyrate acetyltransferase -
BAU10_06530 1417310..1418575 + 1266 ANP64655 diaminobutyrate--2-oxoglutarate transaminase -
BAU10_06535 1418590..1418976 + 387 ANP64656 L-ectoine synthase -
BAU10_06540 1419063..1420484 + 1422 ANP64657 aspartate kinase -
BAU10_06545 1420673..1422301 - 1629 ANP64658 arylsulfatase -
BAU10_06550 1422628..1424958 + 2331 ANP64659 deca-heme c-type cytochrome -
BAU10_06555 1425004..1425792 - 789 ANP64660 sulfatase -
BAU10_06560 1425971..1427296 + 1326 ANP64661 anaerobic sulfatase maturase -
BAU10_06565 1427350..1428447 + 1098 ANP64662 hypothetical protein -
BAU10_06570 1428610..1429608 + 999 ANP64663 haloacid dehalogenase -
BAU10_06575 1429716..1431233 - 1518 ANP64664 arylsulfatase -
BAU10_06580 1431466..1432917 + 1452 ANP64665 arylsulfatase -
BAU10_06585 1433070..1445210 + 12141 ANP64666 RTX toxin -
BAU10_06590 1445207..1447378 + 2172 ANP64667 peptidase C39 -
BAU10_06595 1447375..1448688 + 1314 ANP64668 hemolysin D -
BAU10_06600 1448704..1450017 + 1314 ANP64669 agglutination protein -
BAU10_06605 1450010..1450630 + 621 ANP64670 hypothetical protein -
BAU10_06610 1450620..1451462 + 843 ANP64671 phosphate ABC transporter substrate-binding protein -
BAU10_06615 1451641..1452414 + 774 ANP64672 DeoR family transcriptional regulator -
BAU10_06620 1452426..1453466 + 1041 ANP64673 oxidoreductase -
BAU10_06625 1453463..1453933 + 471 ANP64674 hypothetical protein -
BAU10_06630 1454118..1455695 + 1578 ANP64675 diguanylate cyclase -
BAU10_06635 1455747..1456304 - 558 ANP64676 hypothetical protein -
BAU10_06640 1456784..1457146 + 363 ANP64677 hypothetical protein -
BAU10_06645 1457182..1457646 + 465 ANP64678 acetyltransferase -
BAU10_06650 1457895..1459313 + 1419 ANP64679 dihydroorotate dehydrogenase -
BAU10_06655 1459317..1460654 + 1338 ANP64680 histidine kinase -
BAU10_06660 1460641..1461114 + 474 ANP64681 hypothetical protein -
BAU10_06665 1461222..1462925 - 1704 ANP64682 histidine kinase -
BAU10_06670 1463413..1464630 + 1218 ANP64683 HD family phosphohydrolase -
BAU10_06675 1464833..1465456 + 624 ANP64684 flagellar biosynthesis protein FlgM -
BAU10_06680 1465668..1467212 + 1545 ANP64685 YjjI family glycine radical enzyme -
BAU10_06685 1467235..1468116 + 882 ANP64686 glycine radical enzyme activase -
BAU10_06690 1468136..1469074 - 939 ANP64687 LysR family transcriptional regulator -
BAU10_06695 1469486..1470256 + 771 ANP64688 hypothetical protein -
BAU10_06700 1470417..1471019 + 603 ANP64689 SM-20 protein -
BAU10_06705 1471074..1472339 - 1266 ANP64690 hydrolase -
BAU10_06710 1472969..1474162 + 1194 ANP64691 alcohol dehydrogenase -
BAU10_06715 1474324..1475529 + 1206 ANP64692 tyrosine transporter TyrP -
BAU10_06720 1475804..1476928 + 1125 ANP64693 c-di-GMP phosphodiesterase -
BAU10_06725 1477016..1477234 + 219 ANP64694 hypothetical protein -
BAU10_06730 1477559..1478323 + 765 ANP64695 iron-hydroxamate transporter ATP-binding subunit -
BAU10_06735 1478335..1479219 + 885 ANP64696 ABC transporter substrate-binding protein -
BAU10_06740 1479216..1481192 + 1977 ANP64697 Fe3+-hydroxamate ABC transporter permease FhuB -
BAU10_06745 1481393..1483615 + 2223 ANP64698 ligand-gated channel protein -
BAU10_06750 1483658..1484206 - 549 ANP64699 hypothetical protein -
BAU10_06755 1484458..1486233 - 1776 ANP64700 multidrug ABC transporter permease/ATP-binding protein -
BAU10_06760 1486237..1487976 - 1740 ANP64701 multidrug ABC transporter permease/ATP-binding protein -
BAU10_06765 1488248..1488739 - 492 ANP64702 V10 pilin -
BAU10_06770 1488944..1490287 - 1344 ANP64703 sodium:glutamate symporter -
BAU10_06775 1490714..1491592 - 879 ANP64704 LysR family transcriptional regulator -
BAU10_06780 1491696..1491983 + 288 ANP64705 antibiotic biosynthesis monooxygenase -
BAU10_06785 1491995..1492972 + 978 ANP64706 oxidoreductase -
BAU10_06790 1493057..1493743 - 687 ANP64707 3-methyladenine DNA glycosylase -
BAU10_06795 1493830..1494024 + 195 ANP64708 hypothetical protein -
BAU10_06800 1494110..1496920 - 2811 ANP64709 molecular chaperone DnaK -
BAU10_06805 1496976..1498940 - 1965 ANP64710 molecular chaperone DnaK -
BAU10_06810 1498940..1499572 - 633 ANP64711 hypothetical protein -
BAU10_06815 1499864..1501405 + 1542 ANP64712 diguanylate cyclase -
BAU10_06820 1501489..1502019 + 531 ANP64713 exonuclease -
BAU10_06825 1502261..1502701 - 441 ANP64714 hypothetical protein -
BAU10_06830 1502892..1504832 - 1941 ANP64715 hypothetical protein -
BAU10_06835 1504842..1505192 - 351 ANP64716 hypothetical protein -
BAU10_06840 1505428..1506732 + 1305 ANP66460 MltA-interacting MipA family protein -
BAU10_06845 1506810..1507184 + 375 ANP66461 hypothetical protein -
BAU10_06850 1507279..1507863 - 585 ANP64717 FMN-dependent NADH-azoreductase -
BAU10_06855 1508199..1512035 + 3837 ANP66462 ATP-dependent RNA helicase HrpA -
BAU10_06860 1512218..1512697 + 480 ANP66463 hypothetical protein -
BAU10_06865 1512897..1513412 + 516 ANP64718 hypothetical protein -
BAU10_06870 1513775..1515355 + 1581 ANP64719 BCCT transporter -
BAU10_06875 1515482..1515871 + 390 ANP64720 shikimate kinase -
BAU10_06880 1515891..1516529 - 639 ANP64721 sugar transferase -
BAU10_06885 1516540..1517730 - 1191 ANP64722 glycosyl transferase -
BAU10_06890 1517723..1518841 - 1119 ANP64723 glycosyl transferase -
BAU10_06895 1519063..1520496 - 1434 ANP64724 chain-length determining protein -
BAU10_06900 1520493..1521617 - 1125 ANP64725 glycosyl transferase -
BAU10_06905 1521733..1523097 - 1365 ANP64726 hypothetical protein -
BAU10_06910 1523094..1524524 - 1431 ANP64727 lipopolysaccharide biosynthesis protein -
BAU10_06915 1524517..1525689 - 1173 ANP64728 glycosyltransferase -
BAU10_06920 1525701..1526885 - 1185 ANP64729 glycosyl transferase -
BAU10_06925 1527030..1528100 - 1071 ANP64730 glycosyl transferase family 1 -
BAU10_06930 1528075..1529601 - 1527 ANP64731 sigma-54-dependent Fis family transcriptional regulator -
BAU10_06935 1529910..1530290 - 381 ANP64732 phosphorelay protein LuxU -
BAU10_06940 1530302..1530988 - 687 ANP64733 chromosome partitioning protein ParA -
BAU10_06945 1530988..1533090 - 2103 ANP64734 sugar ABC transporter substrate-binding protein -
BAU10_06950 1533087..1533953 - 867 ANP64735 hypothetical protein -
BAU10_06955 1533980..1534300 - 321 ANP64736 anti-anti-sigma factor -
BAU10_06960 1534724..1535569 + 846 ANP64737 DNA ligase -
BAU10_06965 1535585..1536583 - 999 ANP64738 hypothetical protein -
BAU10_06970 1536718..1538088 - 1371 ANP64739 MATE family efflux transporter -
BAU10_06975 1538481..1539092 + 612 ANP64740 riboflavin synthase subunit alpha -
BAU10_06980 1539168..1539362 - 195 ANP64741 molybdopterin-guanine dinucleotide biosynthesis protein A -
BAU10_06985 1539616..1540482 - 867 ANP64742 hypothetical protein -
BAU10_06990 1540707..1541681 + 975 ANP66464 chemotaxis protein CheC -
BAU10_06995 1541681..1542643 + 963 ANP64743 diguanylate cyclase -
BAU10_07000 1542834..1543178 + 345 ANP64744 topoisomerase II -
BAU10_07005 1543224..1543718 - 495 ANP66465 hydrolase -
BAU10_07010 1543853..1545871 + 2019 ANP64745 chemotaxis protein -
BAU10_07015 1546142..1546555 + 414 ANP66466 DNA mismatch repair protein MutT -
BAU10_07020 1546766..1547146 + 381 ANP64746 hypothetical protein -
BAU10_07025 1547195..1547413 + 219 ANP64747 hypothetical protein -
BAU10_07030 1547517..1548332 - 816 ANP66467 sterol desaturase -
BAU10_07035 1548473..1549222 + 750 ANP64748 DTW domain-containing protein -
BAU10_07040 1549398..1550306 + 909 ANP64749 N-acetylglucosamine kinase -
BAU10_07045 1550533..1550799 - 267 ANP64750 DUF2960 domain-containing protein -
BAU10_07050 1550874..1552652 - 1779 ANP64751 bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/molybdopterin molybdotransferase MoeA -
BAU10_07055 1552649..1553236 - 588 ANP64752 molybdenum cofactor guanylyltransferase MobA -
BAU10_07060 1553214..1553933 - 720 ANP64753 ABC transporter ATP-binding protein -
BAU10_07065 1553984..1554682 - 699 ANP64754 ABC transporter permease -
BAU10_07070 1554689..1555507 - 819 ANP64755 tungsten ABC transporter substrate-binding protein -
BAU10_07075 1555842..1557293 + 1452 ANP64756 sigma-54-dependent Fis family transcriptional regulator -
BAU10_07080 1557283..1559322 + 2040 ANP64757 two-component sensor histidine kinase -
BAU10_07085 1559539..1561131 + 1593 ANP64758 ABC-F family ATPase -
BAU10_07090 1561372..1562196 - 825 ANP64759 formate dehydrogenase family accessory protein FdhD -
BAU10_07095 1562520..1562984 + 465 ANP64760 hypothetical protein -
BAU10_07100 1562974..1563603 + 630 ANP64761 hypothetical protein -
BAU10_07105 1563912..1565573 + 1662 ANP64762 (Fe-S)-binding protein -
BAU10_07110 1565583..1566209 + 627 ANP64763 hypothetical protein -
BAU10_07115 1566283..1566483 + 201 ANP64764 transcriptional initiation protein Tat -
BAU10_07120 1566494..1569349 + 2856 ANP64765 formate dehydrogenase -
BAU10_07125 1569361..1569969 + 609 ANP64766 formate dehydrogenase -
BAU10_07130 1569984..1571036 + 1053 ANP64767 formate dehydrogenase subunit gamma -
BAU10_07135 1571020..1571436 + 417 ANP64768 hypothetical protein -
BAU10_07140 1571860..1576239 + 4380 ANP64769 type IV secretion protein Rhs -
BAU10_07145 1576256..1577137 + 882 ANP64770 hypothetical protein -
BAU10_07150 1577460..1578680 + 1221 ANP64771 ammonium transporter -
BAU10_07155 1579005..1579736 + 732 ANP64772 NAD-dependent protein deacylase -
BAU10_07160 1579825..1580862 - 1038 ANP64773 spermidine/putrescine ABC transporter substrate-binding protein PotD -
BAU10_07165 1581112..1582143 - 1032 ANP64774 spermidine/putrescine ABC transporter substrate-binding protein PotD -
BAU10_07170 1582246..1583016 - 771 ANP64775 spermidine/putrescine ABC transporter permease PotC -
BAU10_07175 1583016..1583876 - 861 ANP64776 spermidine/putrescine ABC transporter permease PotB -
BAU10_07180 1583857..1584972 - 1116 ANP64777 putrescine/spermidine ABC transporter ATP-binding protein -
BAU10_07185 1585373..1586170 + 798 ANP64778 hypothetical protein -
BAU10_07190 1586163..1586999 + 837 ANP64779 glucosaminidase -
BAU10_07195 1587013..1587675 + 663 ANP64780 hypothetical protein -
BAU10_07200 1587874..1588767 + 894 ANP64781 tRNA 2-thiocytidine(32) synthetase TtcA -
BAU10_07205 1588896..1589843 - 948 ANP64782 universal stress protein UspE -
BAU10_07210 1590024..1590770 - 747 ANP64783 transcriptional regulator -
BAU10_07215 1590861..1591541 - 681 ANP64784 cytochrome biogenesis protein -
BAU10_07220 1591549..1591713 - 165 ANP64785 cytochrome oxidase maturation protein, cbb3-type -
BAU10_07225 1591729..1594092 - 2364 ANP64786 ATPase P -
BAU10_07230 1594097..1594573 - 477 ANP64787 hypothetical protein -
BAU10_07235 1594679..1595653 - 975 ANP64788 cytochrome c oxidase, cbb3-type subunit III -
BAU10_07240 1595653..1595826 - 174 ANP64789 cytochrome-c oxidase -
BAU10_07245 1595836..1596456 - 621 ANP64790 cytochrome c oxidase, cbb3-type subunit II -
BAU10_07250 1596469..1597896 - 1428 ANP64791 cytochrome c oxidase, cbb3-type subunit I -
BAU10_07255 1598154..1598510 + 357 ANP64792 hypothetical protein -
BAU10_07260 1598624..1599805 + 1182 ANP64793 histidine kinase -
BAU10_07265 1599795..1601516 + 1722 ANP64794 hybrid sensor histidine kinase/response regulator -
BAU10_07270 1602137..1602460 - 324 ANP64795 hypothetical protein -
BAU10_07275 1602576..1602887 - 312 ANP64796 hypothetical protein -
BAU10_07280 1602903..1603352 - 450 ANP64797 macrodomain Ter protein -
BAU10_07285 1603563..1605203 + 1641 ANP64798 ATP-dependent protease -
BAU10_07290 1605274..1605792 + 519 ANP64799 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA -
BAU10_07295 1605933..1606106 - 174 ANP64800 ribosome modulation factor -
BAU10_07300 1606288..1608021 - 1734 ANP64801 hypothetical protein -
BAU10_07305 1608029..1609948 - 1920 ANP64802 ABC transporter ATP-binding protein -
BAU10_07310 1609926..1610126 - 201 ANP64803 thiol-disulfide isomerase -
BAU10_07315 1610190..1612310 - 2121 ANP64804 23S rRNA (guanine(2445)-N(2))/(guanine(2069)-N(7))- methyltransferase -
BAU10_07320 1612797..1613339 - 543 ANP64805 cell division protein ZapC -
BAU10_07325 1613508..1614518 - 1011 ANP64806 dihydroorotate dehydrogenase (quinone) -
BAU10_07330 1614830..1619671 - 4842 ANP64807 NAD-glutamate dehydrogenase -
BAU10_07335 1620157..1622763 - 2607 ANP64808 aminopeptidase N -
BAU10_07340 1622990..1623655 - 666 ANP64809 hypothetical protein -
BAU10_07345 1623850..1625856 - 2007 ANP64810 C-terminal processing peptidase -
BAU10_07350 1625874..1626500 - 627 ANP64811 RNA chaperone ProQ -
BAU10_07355 1626598..1627071 - 474 ANP64812 Free methionine-(R)-sulfoxide reductase -
BAU10_07360 1627164..1628960 + 1797 ANP64813 ABC transporter ATP-binding protein -
BAU10_07365 1628985..1630235 + 1251 ANP64814 paraquat-inducible protein A -
BAU10_07370 1630228..1632876 + 2649 ANP64815 paraquat-inducible protein B -
BAU10_07375 1633027..1634463 + 1437 ANP64816 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF -
BAU10_07380 1634746..1635579 - 834 ANP64817 GntR family transcriptional regulator -
BAU10_07385 1635772..1637124 + 1353 ANP64818 hypothetical protein -
BAU10_07390 1637158..1637655 - 498 ANP64819 DUF4442 domain-containing protein -
BAU10_07395 1638028..1639086 + 1059 ANP64820 3-deoxy-7-phosphoheptulonate synthase -
BAU10_07400 1639108..1639590 + 483 ANP64821 YajQ family cyclic di-GMP-binding protein -
BAU10_07405 1639693..1640613 - 921 ANP64822 ferrochelatase -
BAU10_07410 1641074..1642102 + 1029 ANP64823 amino acid ABC transporter substrate-binding protein -
BAU10_07415 1642320..1643525 + 1206 ANP64824 amino acid ABC transporter permease -
BAU10_07420 1643527..1644624 + 1098 ANP64825 amino acid ABC transporter permease -
BAU10_07425 1644648..1645397 + 750 ANP64826 ABC transporter ATP-binding protein -
BAU10_07430 1645646..1646314 + 669 ANP64827 BAX inhibitor protein -
BAU10_07435 1646391..1646765 - 375 ANP64828 chromosome partitioning protein ParB -
BAU10_07440 1646957..1647295 - 339 ANP64829 hypothetical protein -
BAU10_07445 1647674..1648003 + 330 ANP64830 sulfur relay protein TusE -
BAU10_07450 1648006..1648278 - 273 ANP64831 acylphosphatase -
BAU10_07455 1648369..1649772 + 1404 ANP64832 chemotaxis protein -
BAU10_07460 1649933..1651126 + 1194 ANP64833 23S rRNA methyltransferase -
BAU10_07465 1651179..1658228 - 7050 Protein_1453 calcium-binding protein -
BAU10_07470 1658265..1662944 - 4680 Protein_1454 calcium-binding protein -
BAU10_07475 1663361..1664674 + 1314 ANP64834 agglutination protein -
BAU10_07480 1664677..1665291 + 615 ANP64835 hypothetical protein -
BAU10_07485 1665379..1690464 - 25086 ANP64836 hypothetical protein -
BAU10_07490 1690865..1692175 + 1311 ANP64837 agglutination protein -
BAU10_07495 1692178..1692792 + 615 ANP64838 hypothetical protein -
BAU10_07500 1692968..1693321 + 354 ANP64839 hypothetical protein -
BAU10_07505 1693508..1695478 + 1971 ANP64840 diguanylate cyclase -
BAU10_07510 1695566..1696264 + 699 ANP64841 transcriptional regulator -
BAU10_07515 1696371..1697063 + 693 ANP64842 SDR family oxidoreductase -
BAU10_07520 1697262..1698062 - 801 ANP64843 2,5-didehydrogluconate reductase B -
BAU10_07525 1698175..1699080 + 906 ANP64844 LysR family transcriptional regulator -
BAU10_07530 1699213..1700118 + 906 ANP64845 LLM class oxidoreductase -
BAU10_07535 1700234..1701118 - 885 ANP64846 LysR family transcriptional regulator -
BAU10_07540 1701278..1702459 + 1182 ANP64847 MFS sugar transporter -
BAU10_07545 1702603..1703124 + 522 ANP66468 TetR family transcriptional regulator -
BAU10_07550 1703121..1704170 + 1050 ANP64848 alcohol dehydrogenase -
BAU10_07555 1704374..1705285 - 912 ANP64849 AraC family transcriptional regulator -
BAU10_07560 1705406..1705924 + 519 ANP64850 isochorismatase -
BAU10_07565 1706045..1706806 + 762 ANP64851 nickel transporter -
BAU10_07570 1706905..1707999 - 1095 ANP64852 hypothetical protein -
BAU10_07575 1708325..1709317 + 993 ANP64853 dehydrogenase -
BAU10_07580 1709465..1710367 - 903 ANP64854 homocysteine methyltransferase -
BAU10_07585 1710643..1711368 - 726 ANP66469 peptide ABC transporter ATP-binding protein -
BAU10_07590 1711392..1712339 - 948 ANP64855 ABC transporter permease -
BAU10_07595 1712475..1713263 - 789 ANP64856 amino acid ABC transporter substrate-binding protein -
BAU10_07600 1713725..1714069 + 345 ANP64857 acyl-CoA synthetase -
BAU10_07605 1714674..1715648 - 975 ANP64858 outer membrane protein C precursor -
BAU10_07610 1715789..1716712 - 924 ANP64859 LysR family transcriptional regulator -
BAU10_07615 1717091..1718260 + 1170 ANP64860 efflux transporter periplasmic adaptor subunit -
BAU10_07620 1718273..1721413 + 3141 ANP64861 multidrug efflux RND transporter permease subunit -
BAU10_07625 1721559..1722488 + 930 ANP64862 LysR family transcriptional regulator -
BAU10_07630 1722683..1723294 + 612 ANP64863 hypothetical protein -
BAU10_07635 1723717..1724616 - 900 ANP64864 LysR family transcriptional regulator -
BAU10_07640 1724729..1725313 + 585 ANP64865 amino acid transporter -
BAU10_07645 1725622..1725963 + 342 ANP64866 transcriptional regulator -
BAU10_07650 1726031..1726687 + 657 ANP64867 7-cyano-7-deazaguanine synthase QueC -
BAU10_07655 1726997..1727647 - 651 ANP66470 7-carboxy-7-deazaguanine synthase QueE -
BAU10_07660 1727864..1728673 + 810 ANP64868 HAD family hydrolase -
BAU10_07665 1728834..1730279 - 1446 ANP64869 DNA mismatch repair protein MutT -
BAU10_07670 1730665..1731996 - 1332 ANP64870 trypsin -
BAU10_07675 1732188..1732667 - 480 ANP64871 histone acetyltransferase -
BAU10_07680 1732857..1734734 - 1878 ANP64872 propionyl-CoA synthetase -
BAU10_07685 1734812..1736008 - 1197 ANP64873 putative AcnD-accessory protein PrpF -
BAU10_07690 1736018..1738609 - 2592 ANP64874 Fe/S-dependent 2-methylisocitrate dehydratase AcnD -
BAU10_07695 1738766..1739908 - 1143 ANP64875 2-methylcitrate synthase -
BAU10_07700 1740041..1740937 - 897 ANP64876 methylisocitrate lyase -
BAU10_07705 1740950..1741663 - 714 ANP64877 GntR family transcriptional regulator -
BAU10_07710 1741927..1742325 - 399 ANP64878 aldehyde-activating protein -
BAU10_07715 1742591..1743562 + 972 ANP64879 transporter -
BAU10_07720 1743801..1744295 + 495 ANP64880 hypothetical protein -
BAU10_07725 1744315..1745841 + 1527 ANP64881 tripartite tricarboxylate transporter TctA -
BAU10_07730 1746121..1746636 + 516 Protein_1506 adenylate kinase -
BAU10_07735 1746718..1747488 + 771 ANP64882 permease -
BAU10_07740 1747782..1748753 - 972 ANP64883 C4-dicarboxylate ABC transporter substrate-binding protein -
BAU10_07745 1749013..1749378 - 366 ANP64884 hypothetical protein -
BAU10_07750 1749732..1750736 - 1005 ANP64885 translocator protein PopD -
BAU10_07755 1750747..1751946 - 1200 ANP64886 translocator protein PopB -
BAU10_07760 1751954..1752439 - 486 ANP64887 CesD/SycD/LcrH family type III secretion system chaperone -
BAU10_07765 1752452..1754275 - 1824 ANP64888 Type III secretion cytoplasmic LcrG inhibitor -
BAU10_07770 1754286..1754570 - 285 ANP64889 type III secretion protein LcrG -
BAU10_07775 1754631..1755044 - 414 ANP64890 type III secretion system regulator LcrR -
BAU10_07780 1755044..1757161 - 2118 ANP64891 EscV/YscV/HrcV family type III secretion system export apparatus protein -
BAU10_07785 1757154..1757495 - 342 ANP64892 translocation protein Y -
BAU10_07790 1757501..1757878 - 378 ANP64893 type III secretion protein, YscX family -
BAU10_07795 1757875..1758249 - 375 ANP64894 type III secretion chaperone SycN -
BAU10_07800 1758236..1758520 - 285 ANP64895 SepL/TyeA/HrpJ family type III secretion system gatekeeper -
BAU10_07805 1758501..1759394 - 894 ANP64896 hypothetical protein -
BAU10_07810 1759580..1760902 + 1323 ANP64897 EscN/YscN/HrcN family type III secretion system ATPase -
BAU10_07815 1760899..1761360 + 462 ANP64898 type III secretion protein -
BAU10_07820 1761370..1762575 + 1206 ANP64899 type III secretion system needle length determinant -
BAU10_07825 1762572..1763540 + 969 ANP64900 type III secretion system protein -
BAU10_07830 1763537..1764187 + 651 ANP64901 EscR/YscR/HrcR family type III secretion system export apparatus protein -
BAU10_07835 1764201..1764467 + 267 ANP64902 EscS/YscS/HrcS family type III secretion system export apparatus protein -
BAU10_07840 1764464..1765249 + 786 ANP64903 EscT/YscT/HrcT family type III secretion system export apparatus protein -
BAU10_07845 1765265..1766314 + 1050 ANP64904 EscU/YscU/HrcU family type III secretion system export apparatus switch protein -
BAU10_07850 1766417..1767127 + 711 ANP64905 AraC family transcriptional regulator -
BAU10_07855 1767240..1768136 + 897 ANP64906 hypothetical protein -
BAU10_07860 1768226..1769704 - 1479 ANP64907 cation transporter -
BAU10_07865 1769714..1770172 - 459 ANP64908 type III secretion chaperone CesT -
BAU10_07870 1770412..1770858 - 447 ANP64909 type III secretion chaperone CesT -
BAU10_07875 1771114..1772277 - 1164 ANP64910 effector protein -
BAU10_07880 1772281..1772712 - 432 ANP64911 type III chaperone -
BAU10_07885 1772898..1773536 - 639 ANP64912 type III secretion system protein -
BAU10_07890 1773515..1774180 - 666 ANP64913 type III secretion protein -
BAU10_07895 1774173..1774916 - 744 ANP64914 EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein -
BAU10_07900 1774919..1775263 - 345 ANP64915 EscI/YscI/HrpB family type III secretion system inner rod protein -
BAU10_07905 1775272..1775907 - 636 ANP64916 type III secretion effector, YopR family -
BAU10_07910 1775904..1776263 - 360 ANP64917 type III secretion protein, YscG family -
BAU10_07915 1776267..1776515 - 249 ANP64918 EscF/YscF/HrpA family type III secretion system needle major subunit -
BAU10_07920 1776534..1776737 - 204 ANP64919 EscE/YscE/SsaE family type III secretion system needle protein co-chaperone -
BAU10_07925 1776724..1778025 - 1302 ANP64920 EscD/YscD/HrpQ family type III secretion system inner membrane ring protein -
BAU10_07930 1778031..1779905 - 1875 ANP64921 EscC/YscC/HrcC family type III secretion system outer membrane ring protein -
BAU10_07935 1779902..1780330 - 429 ANP64922 type III secretion system chaperone, YscB family -
BAU10_07940 1780343..1781323 - 981 ANP64923 Type III secretion negative regulator (LscZ) -
BAU10_07945 1781472..1782332 - 861 ANP64924 transcriptional regulator -
BAU10_07950 1782942..1783355 - 414 ANP64925 type III secretion system chaperone YscW -
BAU10_07955 1783744..1784190 + 447 ANP64926 exoenzyme S synthesis protein C -
BAU10_07960 1784199..1784504 + 306 ANP64927 Type III secretion regulator ExsE -
BAU10_07965 1784631..1786151 - 1521 ANP64928 aldehyde dehydrogenase -
BAU10_07970 1786391..1788157 + 1767 ANP64929 sigma-54-dependent Fis family transcriptional regulator -
BAU10_07975 1788935..1789138 + 204 ANP64930 hypothetical protein -
BAU10_07980 1789149..1789676 - 528 ANP64931 hypothetical protein -
BAU10_07985 1789673..1790527 - 855 ANP64932 hypothetical protein -
BAU10_07990 1790725..1792173 - 1449 ANP64933 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) -
BAU10_07995 1792212..1792928 - 717 ANP64934 6-phosphogluconolactonase -
BAU10_08000 1792925..1794427 - 1503 ANP64935 glucose-6-phosphate dehydrogenase -
BAU10_08005 1794965..1795930 + 966 ANP64936 AraC family transcriptional regulator -
BAU10_08010 1796031..1798166 + 2136 ANP64937 ligand-gated channel protein -
BAU10_08015 1798258..1798944 - 687 ANP64938 two-component system response regulator -
BAU10_08020 1798941..1800560 - 1620 ANP64939 histidine kinase -
BAU10_08025 1801037..1801264 + 228 ANP64940 hypothetical protein -
BAU10_08030 1801395..1802810 + 1416 ANP64941 hypothetical protein -
BAU10_08035 1802814..1803794 + 981 ANP64942 hypothetical protein -
BAU10_08040 1803817..1804983 + 1167 ANP64943 multidrug ABC transporter permease -
BAU10_08045 1804980..1806131 + 1152 ANP64944 ABC transporter -
BAU10_08050 1806418..1807326 - 909 ANP64945 LysR family transcriptional regulator -
BAU10_08055 1807469..1807897 - 429 ANP64946 hypothetical protein -
BAU10_08060 1807915..1809084 - 1170 ANP64947 phospholipase -
BAU10_08065 1809295..1810152 - 858 ANP64948 pyridoxal kinase -
BAU10_08070 1810278..1811873 - 1596 ANP64949 aspartate 4-decarboxylase -
BAU10_08075 1811969..1813684 - 1716 ANP64950 aspartate-alanine antiporter -
BAU10_08080 1814111..1814323 + 213 ANP64951 hypothetical protein -
BAU10_08085 1814334..1815197 + 864 ANP64952 efflux transporter periplasmic adaptor subunit -
BAU10_08090 1815211..1816566 + 1356 ANP64953 fusaric acid resistance protein -
BAU10_08095 1816868..1818523 + 1656 ANP64954 hypothetical protein -
BAU10_08100 1818734..1820773 + 2040 ANP64955 para-nitrobenzyl esterase -
BAU10_08105 1820875..1822326 + 1452 ANP64956 phospholipase -
BAU10_08110 1822384..1824090 - 1707 ANP64957 hypothetical protein -
BAU10_08115 1824378..1824842 - 465 ANP64958 hypothetical protein -
BAU10_08120 1825012..1825638 - 627 ANP64959 lysine transporter LysE -
BAU10_08125 1825966..1826592 - 627 ANP64960 amino acid transporter -
BAU10_08130 1826722..1827075 - 354 ANP64961 RNA signal recognition particle -
BAU10_08135 1827173..1827778 - 606 ANP64962 hypothetical protein -
BAU10_08140 1827860..1828156 - 297 ANP64963 hypothetical protein -
BAU10_08145 1828300..1828587 - 288 ANP64964 antibiotic biosynthesis monooxygenase -
BAU10_08150 1828716..1829357 - 642 ANP64965 alanyl-tRNA editing protein -
BAU10_08155 1829500..1830045 - 546 ANP64966 GCN5 family acetyltransferase -
BAU10_08160 1830299..1830862 - 564 ANP64967 maltose O-acetyltransferase -
BAU10_08165 1831006..1831419 - 414 ANP64968 hypothetical protein -
BAU10_08170 1831561..1832169 - 609 ANP64969 phosphohydrolase -
BAU10_08175 1832313..1832714 - 402 ANP64970 phosphoenolpyruvate synthase -
BAU10_08180 1832819..1833340 - 522 ANP64971 acetyltransferase -
BAU10_08185 1833680..1834636 + 957 ANP64972 transposase -
BAU10_08190 1834659..1835135 - 477 Protein_1598 histone acetyltransferase -
BAU10_08195 1835277..1835810 - 534 ANP64973 hypothetical protein -
BAU10_08200 1836010..1837563 - 1554 ANP66471 hypothetical protein -
BAU10_08205 1837993..1838949 + 957 ANP64974 transposase -
BAU10_08210 1840224..1840424 - 201 Protein_1602 hypothetical protein -
BAU10_08215 1840886..1841842 + 957 ANP64975 transposase -
BAU10_08220 1843117..1843317 - 201 Protein_1604 hypothetical protein -
BAU10_08225 1843779..1844735 + 957 ANP64976 transposase -
BAU10_08230 1844758..1845288 - 531 ANP64977 hypothetical protein -
BAU10_08235 1845432..1845836 - 405 ANP64978 hypothetical protein -
BAU10_08240 1845990..1846568 - 579 ANP64979 hypothetical protein -
BAU10_08245 1846908..1847864 + 957 ANP64980 transposase -
BAU10_08250 1847899..1848351 - 453 ANP64981 hypothetical protein -
BAU10_08255 1848458..1849063 - 606 ANP64982 hypothetical protein -
BAU10_08260 1849260..1849544 + 285 ANP64983 damage-inducible protein J -
BAU10_08265 1849541..1849819 + 279 ANP64984 plasmid stabilization protein ParE -
BAU10_08270 1850572..1850784 - 213 ANP64985 hypothetical protein -
BAU10_08275 1852023..1852742 - 720 ANP64986 hypothetical protein -
BAU10_08280 1852890..1853540 - 651 ANP64987 hypothetical protein -
BAU10_08285 1853884..1854840 + 957 ANP64988 transposase -
BAU10_08290 1854875..1855342 - 468 ANP64989 XRE family transcriptional regulator -
BAU10_08295 1855582..1855989 - 408 ANP64990 hypothetical protein -
BAU10_08300 1856317..1857273 + 957 ANP64991 integrase -
BAU10_08305 1858644..1859021 + 378 ANP64992 hypothetical protein -
BAU10_08310 1859168..1862050 - 2883 ANP64993 hypothetical protein -
BAU10_08315 1862025..1862447 - 423 ANP64994 hypothetical protein -
BAU10_08320 1862466..1862954 - 489 ANP64995 hypothetical protein -
BAU10_08325 1863048..1866410 - 3363 ANP64996 hypothetical protein -
BAU10_08330 1866410..1866883 - 474 ANP64997 hypothetical protein -
BAU10_08335 1866873..1869059 - 2187 ANP64998 hypothetical protein -
BAU10_08340 1869310..1869660 - 351 ANP64999 hypothetical protein -
BAU10_08345 1869677..1870123 - 447 ANP65000 hypothetical protein -
BAU10_08350 1870139..1870525 - 387 ANP65001 hypothetical protein -
BAU10_08355 1870522..1870959 - 438 ANP65002 hypothetical protein -
BAU10_08360 1870962..1871312 - 351 ANP65003 hypothetical protein -
BAU10_08365 1871319..1871651 - 333 ANP65004 hypothetical protein -
BAU10_08370 1871644..1871856 - 213 ANP65005 hypothetical protein -
BAU10_08375 1871917..1873113 - 1197 ANP65006 hypothetical protein -
BAU10_08380 1873146..1873760 - 615 ANP65007 peptidase -
BAU10_08385 1873753..1874952 - 1200 ANP65008 phage portal protein -
BAU10_08390 1875103..1876836 - 1734 ANP65009 terminase -
BAU10_08395 1876839..1877291 - 453 ANP65010 hypothetical protein -
BAU10_08400 1877650..1878009 - 360 ANP65011 DNAse -
BAU10_08405 1878348..1878590 - 243 ANP65012 hypothetical protein -
BAU10_08410 1878702..1878965 - 264 ANP65013 hypothetical protein -
BAU10_08415 1879006..1879332 - 327 ANP66472 hypothetical protein -
BAU10_08420 1879346..1879636 - 291 ANP65014 hypothetical protein -
BAU10_08425 1879707..1880396 - 690 ANP65015 hypothetical protein -
BAU10_08430 1880502..1880876 + 375 ANP65016 hypothetical protein -
BAU10_08435 1881073..1881678 + 606 ANP65017 hypothetical protein -
BAU10_08440 1881888..1882136 + 249 ANP65018 hypothetical protein -
BAU10_08445 1882172..1882450 + 279 ANP65019 hypothetical protein -
BAU10_08450 1882562..1883533 - 972 ANP65020 hypothetical protein -
BAU10_08455 1883544..1883849 - 306 ANP65021 nucleoside 2-deoxyribosyltransferase -
BAU10_08460 1883846..1884154 - 309 ANP65022 hypothetical protein -
BAU10_08465 1884151..1884339 - 189 ANP65023 hypothetical protein -
BAU10_08470 1884336..1885037 - 702 ANP65024 DNA-binding protein -
BAU10_08475 1885204..1886190 - 987 ANP65025 transcriptional regulator -
BAU10_08480 1886190..1886768 - 579 ANP65026 phage N-6-adenine-methyltransferase -
BAU10_08485 1887121..1887312 - 192 ANP65027 hypothetical protein -
BAU10_08490 1887309..1887818 - 510 ANP65028 hypothetical protein -
BAU10_08495 1888098..1888898 + 801 ANP65029 XRE family transcriptional regulator -
BAU10_08500 1888992..1889534 + 543 ANP65030 hypothetical protein -
BAU10_08505 1889880..1890272 + 393 ANP65031 hypothetical protein -
BAU10_08510 1890313..1891131 + 819 ANP65032 hypothetical protein -
BAU10_08515 1891183..1891560 + 378 ANP65033 hypothetical protein -
BAU10_08520 1891562..1891774 + 213 ANP65034 hypothetical protein -
BAU10_08525 1891767..1892024 + 258 ANP65035 hypothetical protein -
BAU10_08530 1892024..1892239 + 216 ANP65036 hypothetical protein -
BAU10_08535 1892344..1892574 + 231 ANP65037 hypothetical protein -
BAU10_08540 1892574..1893809 + 1236 ANP65038 integrase -
BAU10_08545 1893957..1894586 - 630 ANP65039 hypothetical protein -
BAU10_08550 1894963..1895436 - 474 ANP65040 hypothetical protein -
BAU10_08555 1895450..1896037 - 588 ANP65041 phosphohydrolase -
BAU10_08560 1896039..1896623 - 585 ANP65042 ribosomal-protein-alanine acetyltransferase -
BAU10_08565 1896660..1898204 - 1545 ANP65043 DNA-binding transcriptional regulator TyrR -
BAU10_08570 1898305..1899345 - 1041 ANP65044 TIGR01620 family protein -
BAU10_08575 1899342..1900718 - 1377 ANP65045 nucleoside triphosphate hydrolase -
BAU10_08580 1900975..1901160 - 186 ANP65046 hypothetical protein -
BAU10_08585 1901335..1902852 - 1518 ANP65047 fumarate hydratase -
BAU10_08590 1903123..1904487 + 1365 ANP65048 aminodeoxychorismate synthase, component I -
BAU10_08595 1904848..1906548 - 1701 ANP65049 hybrid sensor histidine kinase/response regulator -
BAU10_08600 1906556..1907095 - 540 ANP65050 guanylate cyclase -
BAU10_08605 1907327..1907926 + 600 ANP65051 coenzyme A pyrophosphatase -
BAU10_08610 1908272..1909525 + 1254 ANP65052 septum formation protein -
BAU10_08615 1909623..1910984 + 1362 ANP65053 L-serine ammonia-lyase -
BAU10_08620 1911196..1912911 + 1716 ANP65054 diguanylate cyclase -
BAU10_08625 1913006..1913473 + 468 ANP65055 acetyltransferase -
BAU10_08630 1913563..1913925 - 363 ANP65056 6-carboxytetrahydropterin synthase QueD -
BAU10_08635 1914219..1915844 + 1626 ANP65057 chemotaxis protein -
BAU10_08640 1916034..1917434 + 1401 ANP65058 asparagine--tRNA ligase -
BAU10_08645 1917526..1917750 - 225 ANP65059 hypothetical protein -
BAU10_08650 1917849..1919240 - 1392 ANP65060 GntR family transcriptional regulator -
BAU10_08655 1919500..1919730 + 231 ANP65061 hypothetical protein -
BAU10_08660 1919976..1920275 + 300 ANP65062 hypothetical protein -
BAU10_08665 1920608..1921798 + 1191 ANP65063 aromatic amino acid aminotransferase -
BAU10_08670 1921888..1922529 - 642 ANP65064 hypothetical protein -
BAU10_08675 1922844..1924733 + 1890 ANP65065 cyclic nucleotide-binding protein -
BAU10_08680 1924745..1925461 + 717 ANP66473 DNA polymerase III subunit epsilon -
BAU10_08685 1925533..1927416 - 1884 ANP65066 chemotaxis protein -
BAU10_08690 1927648..1929219 - 1572 ANP65067 BCCT transporter -
BAU10_08695 1929607..1930083 + 477 ANP66474 MarR family transcriptional regulator -
BAU10_08700 1930124..1930762 - 639 ANP65068 DNA-binding response regulator -
BAU10_08705 1930755..1932110 - 1356 ANP65069 histidine kinase -
BAU10_08710 1932262..1933548 - 1287 ANP65070 C4-dicarboxylate ABC transporter -
BAU10_08715 1933561..1934100 - 540 ANP65071 C4-dicarboxylate ABC transporter -
BAU10_08720 1934216..1935307 - 1092 ANP65072 ABC transporter substrate-binding protein -
BAU10_08725 1935722..1936126 - 405 ANP65073 hypothetical protein -
BAU10_08730 1936400..1937065 + 666 ANP65074 hypothetical protein -
BAU10_08735 1937084..1937740 - 657 ANP65075 hypothetical protein -
BAU10_08740 1937870..1938418 - 549 ANP65076 hypothetical protein -
BAU10_08745 1938585..1940126 - 1542 ANP65077 peptidase -
BAU10_08750 1940280..1941362 - 1083 ANP65078 hypothetical protein -
BAU10_08755 1941343..1942380 - 1038 ANP65079 iron-regulated protein A -
BAU10_08760 1942391..1943773 - 1383 ANP65080 thiol oxidoreductase -
BAU10_08765 1943866..1945128 - 1263 ANP65081 peptidase -
BAU10_08770 1945303..1945899 - 597 ANP66475 GTP cyclohydrolase -
BAU10_08775 1946171..1946356 - 186 ANP65082 hypothetical protein -
BAU10_08780 1946494..1946904 - 411 ANP65083 cytochrome C nitrite reductase -
BAU10_08785 1946891..1947424 - 534 ANP65084 thiol:disulfide interchange protein -
BAU10_08790 1947402..1949309 - 1908 ANP65085 cytochrome c nitrate reductase biogenesis protein NrfE -
BAU10_08795 1949319..1950290 - 972 ANP65086 cytochrome c nitrite reductase subunit NrfD -
BAU10_08800 1950287..1950973 - 687 ANP65087 cytochrome c nitrite reductase Fe-S protein -
BAU10_08805 1950975..1951577 - 603 ANP65088 cytochrome c nitrite reductase pentaheme subunit -
BAU10_08810 1951742..1953169 + 1428 ANP66476 nitrite reductase (cytochrome; ammonia-forming) c552 subunit -
BAU10_08815 1953288..1953842 - 555 ANP65089 hypothetical protein -
BAU10_08820 1953885..1954508 - 624 ANP65090 hypothetical protein -
BAU10_08825 1954632..1957343 - 2712 ANP65091 DNA gyrase subunit A -
BAU10_08830 1957819..1958526 + 708 ANP65092 bifunctional 3-demethylubiquinol 3-O-methyltransferase/2-polyprenyl-6-hydroxyphenol methylase -
BAU10_08835 1959028..1961310 + 2283 ANP65093 ribonucleoside-diphosphate reductase subunit alpha -
BAU10_08840 1961394..1962527 + 1134 ANP65094 ribonucleotide-diphosphate reductase subunit beta -
BAU10_08845 1962527..1962808 + 282 ANP65095 (2Fe-2S)-binding protein -
BAU10_08850 1962905..1964137 - 1233 ANP65096 competence/damage-inducible protein A -
BAU10_08855 1964329..1965231 + 903 ANP65097 ubiquitin--protein ligase -
BAU10_08860 1965453..1965965 + 513 ANP65098 transcriptional regulator -
BAU10_08865 1966043..1967176 - 1134 ANP65099 carboxynorspermidine decarboxylase -
BAU10_08870 1967280..1968524 - 1245 ANP65100 saccharopine dehydrogenase -
BAU10_08875 1968543..1971419 - 2877 ANP65101 aminotransferase class III -
BAU10_08900 1973540..1974097 - 558 ANP65102 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
BAU10_08905 1974144..1975910 - 1767 ANP65103 excinuclease ABC subunit C -
BAU10_08910 1975978..1976622 - 645 ANP65104 two-component system response regulator UvrY -
BAU10_08915 1977050..1979413 + 2364 ANP65105 DNA polymerase II -
BAU10_08920 1979410..1980177 - 768 ANP65106 nucleotidyltransferase -
BAU10_08925 1980372..1980938 + 567 ANP65107 elongation factor P-like protein YeiP -
BAU10_08930 1980941..1981261 + 321 ANP65108 hypothetical protein -
BAU10_08935 1981449..1982387 - 939 ANP65109 23S rRNA pseudouridylate synthase B -
BAU10_08940 1982953..1983663 + 711 ANP65110 hcalcium-binding protein -
BAU10_08945 1983757..1984377 - 621 ANP65111 threonylcarbamoyl-AMP synthase -
BAU10_08950 1984437..1985294 - 858 ANP65112 phosphatase -
BAU10_08955 1985390..1985515 + 126 ANP65113 Trp operon leader peptide -
BAU10_08960 1985692..1987257 + 1566 ANP65114 anthranilate synthase component I -
BAU10_08965 1987274..1987882 + 609 ANP65115 anthranilate synthase component II -
BAU10_08970 1987920..1988930 + 1011 ANP65116 anthranilate phosphoribosyltransferase -
BAU10_08975 1988944..1990383 + 1440 ANP65117 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase -
BAU10_08980 1990448..1991638 + 1191 ANP65118 tryptophan synthase subunit beta -
BAU10_08985 1991638..1992444 + 807 ANP65119 tryptophan synthase subunit alpha -
BAU10_08990 1992641..1993336 + 696 ANP65120 transcriptional regulator -
BAU10_08995 1993463..1995004 - 1542 ANP65121 long-chain-fatty-acid--CoA ligase -
BAU10_09000 1995227..1995436 - 210 ANP65122 hypothetical protein -
BAU10_09005 1995548..1996807 + 1260 ANP65123 amino acid:proton symporter -
BAU10_09010 1996964..1998148 + 1185 ANP65124 acyl-homoserine-lactone synthase -
BAU10_09015 1998141..2000681 + 2541 ANP65125 hybrid sensor histidine kinase/response regulator -
BAU10_09020 2000793..2001035 + 243 ANP65126 hypothetical protein -
BAU10_09025 2001234..2001797 + 564 ANP65127 septation protein A -
BAU10_09030 2002023..2002418 + 396 ANP65128 acyl-CoA thioesterase -
BAU10_09035 2002534..2002830 + 297 ANP65129 hypothetical protein -
BAU10_09040 2002834..2003226 + 393 ANP65130 hypothetical protein -
BAU10_09045 2003360..2005642 - 2283 ANP65131 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase -
BAU10_09050 2005924..2006835 + 912 ANP65132 transcriptional regulator -
BAU10_09055 2006857..2007057 - 201 ANP65133 hypothetical protein -
BAU10_09060 2007210..2007920 - 711 ANP65134 hypothetical protein -
BAU10_09065 2008006..2010462 - 2457 ANP65135 diguanylate phosphodiesterase -
BAU10_09070 2010888..2013221 + 2334 ANP65136 YgiQ family radical SAM protein -
BAU10_09075 2013484..2016981 + 3498 ANP65137 hypothetical protein -
BAU10_09080 2016985..2017932 + 948 ANP65138 hypothetical protein -
BAU10_09085 2017936..2018881 + 946 Protein_1773 hypothetical protein -
BAU10_09090 2018885..2019829 + 945 ANP65139 hypothetical protein -
BAU10_09095 2019957..2020379 - 423 ANP65140 polysaccharide biosynthesis protein GtrA -
BAU10_09100 2020384..2021790 - 1407 ANP65141 dolichyl-phosphate-mannose--protein mannosyltransferase -
BAU10_09105 2021793..2022794 - 1002 ANP66477 glycosyl transferase family 2 -
BAU10_09110 2022986..2023663 + 678 ANP65142 two-component system response regulator -
BAU10_09115 2023660..2024946 + 1287 ANP65143 two-component sensor histidine kinase -
BAU10_09120 2025056..2025952 + 897 ANP66478 1-aminocyclopropane-1-carboxylate deaminase -
BAU10_09125 2025992..2026534 - 543 ANP65144 hydrolase -
BAU10_09130 2026685..2027545 - 861 ANP65145 LysR family transcriptional regulator -
BAU10_09135 2027645..2028709 + 1065 ANP65146 multidrug transporter -
BAU10_09140 2028719..2029738 + 1020 ANP65147 MFS transporter -
BAU10_09145 2030936..2031964 - 1029 ANP65148 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase -
BAU10_09150 2031995..2032969 - 975 ANP65149 hypothetical protein -
BAU10_09155 2034070..2034987 + 918 ANP65150 dTDP-glucose 4,6-dehydratase -
BAU10_09160 2035063..2035746 + 684 ANP65151 topoisomerase I -
BAU10_09165 2035812..2036546 - 735 ANP65152 macrolide ABC transporter ATP-binding protein -
BAU10_09170 2036539..2037822 - 1284 ANP65153 peptide ABC transporter permease -
BAU10_09175 2037825..2039039 - 1215 ANP65154 ABC transporter substrate-binding protein -
BAU10_09180 2039036..2040307 - 1272 ANP65155 hypothetical protein -
BAU10_09185 2040300..2041433 - 1134 ANP65156 efflux transporter periplasmic adaptor subunit -
BAU10_09190 2041662..2042066 - 405 ANP66479 hypothetical protein -
BAU10_09195 2042099..2042872 - 774 ANP65157 hypothetical protein -
BAU10_09200 2043296..2043517 + 222 ANP65158 hypothetical protein -
BAU10_09205 2043567..2044082 - 516 ANP65159 redoxin -
BAU10_09210 2044079..2046190 - 2112 ANP65160 cytochrome C biogenesis protein -
BAU10_09215 2046255..2046653 - 399 ANP65161 hypothetical protein -
BAU10_09220 2046756..2047358 - 603 ANP65162 DNA-binding response regulator -
BAU10_09225 2047384..2049210 - 1827 ANP65163 histidine kinase -
BAU10_09230 2049390..2050154 + 765 ANP65164 4Fe-4S ferredoxin -
BAU10_09235 2050151..2051281 + 1131 ANP65165 tetrathionate reductase -
BAU10_09240 2051299..2054391 + 3093 ANP65166 tetrathionate reductase subunit A -
BAU10_09245 2054621..2055232 + 612 ANP65167 cystathionine beta-synthase -
BAU10_09250 2055241..2056293 + 1053 ANP65168 cytochrome C -
BAU10_09255 2056598..2057929 + 1332 ANP65169 paraquat-inducible protein A -
BAU10_09260 2057922..2059568 + 1647 ANP65170 paraquat-inducible protein B -
BAU10_09265 2059568..2060146 + 579 ANP65171 hypothetical protein -
BAU10_09270 2060249..2061022 + 774 ANP65172 hypothetical protein -
BAU10_09275 2061229..2061468 + 240 ANP65173 hypothetical protein -
BAU10_09280 2061529..2063367 - 1839 ANP65174 diguanylate cyclase -
BAU10_09285 2063867..2064568 - 702 ANP65175 orotidine 5'-phosphate decarboxylase -
BAU10_09290 2064653..2065828 - 1176 ANP65176 lipopolysaccharide assembly protein LapB -
BAU10_09295 2065847..2066143 - 297 ANP65177 hypothetical protein -
BAU10_09300 2066413..2066694 - 282 ANP65178 integration host factor subunit beta -
BAU10_09305 2066908..2068578 - 1671 ANP65179 30S ribosomal protein S1 -
BAU10_09310 2068689..2069369 - 681 ANP66480 cytidylate kinase -
BAU10_09315 2069578..2070639 - 1062 ANP65180 protease SohB -
BAU10_09320 2070894..2071640 + 747 ANP65181 YciK family oxidoreductase -
BAU10_09325 2071770..2072462 + 693 ANP65182 recombinase RecA -
BAU10_09330 2072467..2073870 + 1404 ANP65183 nucleotidyltransferase -
BAU10_09335 2073898..2076972 + 3075 ANP65184 error-prone DNA polymerase -
BAU10_09340 2077045..2077998 - 954 ANP65185 chemotaxis protein CheW -
BAU10_09345 2078362..2079579 - 1218 ANP65186 transcriptional regulator -
BAU10_09350 2079990..2081432 + 1443 ANP65187 pyruvate kinase -
BAU10_09355 2081541..2082692 - 1152 ANP65188 patatin family protein -
BAU10_09360 2082957..2083547 + 591 ANP65189 hypothetical protein -
BAU10_09365 2084117..2085583 + 1467 ANP65190 transporter -
BAU10_09370 2085744..2086145 - 402 ANP65191 hypothetical protein -
BAU10_09375 2086359..2087789 - 1431 ANP65192 PTS glucose transporter subunit IIBC -
BAU10_09380 2088234..2089001 - 768 ANP65193 metal-dependent hydrolase -
BAU10_09385 2088992..2089954 - 963 ANP65194 DNA polymerase III subunit delta' -
BAU10_09390 2089979..2090611 - 633 ANP65195 dTMP kinase -
BAU10_09395 2090608..2091624 - 1017 ANP65196 ABC transporter substrate-binding protein -
BAU10_09400 2091621..2092436 - 816 ANP65197 aminodeoxychorismate lyase -
BAU10_09405 2092544..2093794 - 1251 ANP65198 beta-ketoacyl-[acyl-carrier-protein] synthase II -
BAU10_09410 2093888..2094121 - 234 ANP65199 acyl carrier protein -
BAU10_09415 2094368..2095102 - 735 ANP66481 3-oxoacyl-ACP reductase -
BAU10_09420 2095148..2096071 - 924 ANP65200 malonyl CoA-acyl carrier protein transacylase -
BAU10_09425 2096147..2097097 - 951 ANP65201 3-oxoacyl-ACP synthase -
BAU10_09430 2097103..2098128 - 1026 ANP65202 phosphate acyltransferase -
BAU10_09435 2098139..2098309 - 171 ANP65203 50S ribosomal protein L32 -
BAU10_09440 2098369..2098893 - 525 ANP65204 ribosomal protein L32p -
BAU10_09445 2099043..2099624 + 582 ANP65205 septum formation protein Maf -
BAU10_09450 2099683..2100627 - 945 ANP66482 RNA pseudouridine synthase -
BAU10_09455 2101267..2104332 + 3066 ANP65206 ribonuclease -
BAU10_09460 2104665..2106224 + 1560 ANP65207 sodium-independent anion transporter -
BAU10_09465 2106285..2106734 - 450 ANP65208 protein-tyrosine-phosphatase -
BAU10_09470 2106852..2107457 + 606 ANP65209 cob(I)yrinic acid a,c-diamide adenosyltransferase -
BAU10_09475 2107520..2109607 - 2088 ANP65210 cell envelope biogenesis protein AsmA -
BAU10_09480 2109796..2110437 - 642 ANP65211 uridine kinase -
BAU10_09485 2110618..2111694 - 1077 ANP65212 sodium:proton antiporter -
BAU10_09490 2111857..2113932 + 2076 ANP65213 methionine--tRNA ligase -
BAU10_09495 2114143..2114952 + 810 ANP65214 hypothetical protein -
BAU10_09500 2115063..2115902 - 840 ANP65215 fatty acid metabolism regulator -
BAU10_09505 2116542..2118128 + 1587 ANP65216 Na+/H+ antiporter NhaB -
BAU10_09510 2118212..2118748 + 537 ANP65217 disulfide bond formation protein B -
BAU10_09515 2118837..2119445 - 609 ANP65218 prepilin peptidase -
BAU10_09520 2119616..2120575 + 960 ANP65219 tRNA dihydrouridine synthase DusC -
BAU10_09525 2120627..2122087 - 1461 ANP65220 diguanylate cyclase -
BAU10_09530 2122262..2124088 - 1827 ANP65221 maltodextrin glucosidase -
BAU10_09535 2124230..2125024 - 795 ANP65222 ABC transporter ATP-binding protein -
BAU10_09540 2125021..2125956 - 936 ANP65223 ABC transporter permease -
BAU10_09545 2126132..2127097 - 966 ANP65224 ABC transporter substrate-binding protein -
BAU10_09550 2127428..2127880 - 453 ANP65225 hypothetical protein -
BAU10_09555 2128227..2129423 + 1197 ANP65226 acetate kinase -
BAU10_09560 2129560..2131704 + 2145 ANP65227 phosphate acetyltransferase -
BAU10_09565 2132047..2132469 + 423 ANP65228 hypothetical protein -
BAU10_09570 2132583..2133530 - 948 ANP65229 glutathione-dependent reductase -
BAU10_09575 2133698..2134711 - 1014 ANP65230 oligopeptide ABC transporter ATP-binding protein OppF -
BAU10_09580 2134690..2135661 - 972 ANP65231 oligopeptide ABC transporter ATP-binding protein OppD -
BAU10_09585 2135689..2136591 - 903 ANP65232 peptide ABC transporter permease -
BAU10_09590 2136607..2137527 - 921 ANP65233 oligopeptide transporter permease -
BAU10_09595 2137656..2139332 - 1677 ANP66483 oligopeptide ABC transporter substrate-binding protein OppA -
BAU10_09600 2139864..2140319 - 456 ANP65234 molybdopterin synthase catalytic subunit -
BAU10_09605 2140321..2140578 - 258 ANP65235 molybdopterin synthase sulfur carrier subunit -
BAU10_09610 2140575..2141054 - 480 ANP65236 molybdenum cofactor biosynthesis protein C -
BAU10_09615 2141081..2141593 - 513 ANP65237 molybdenum cofactor biosynthesis protein B -
BAU10_09620 2141695..2142684 - 990 ANP65238 cyclic pyranopterin phosphate synthase -
BAU10_09625 2142983..2143879 + 897 ANP65239 hypothetical protein -
BAU10_09630 2144018..2144362 - 345 ANP65240 phosphorelay protein LuxU -
BAU10_09635 2144359..2145765 - 1407 ANP65241 sigma-54-dependent Fis family transcriptional regulator -
BAU10_09640 2146056..2148086 - 2031 ANP65242 excinuclease ABC subunit B -
BAU10_09650 2149071..2151368 + 2298 ANP65243 formate acetyltransferase -
BAU10_09655 2151674..2152252 + 579 ANP65244 electron transport complex subunit RsxA -
BAU10_09660 2152256..2152852 + 597 ANP65245 electron transport complex subunit RsxB -
BAU10_09665 2152861..2155269 + 2409 ANP65246 electron transport complex subunit RsxC -
BAU10_09670 2155269..2156315 + 1047 ANP65247 electron transport complex subunit RsxD -
BAU10_09675 2156323..2156955 + 633 ANP65248 electron transport complex subunit RsxG -
BAU10_09680 2156955..2157647 + 693 ANP65249 electron transport complex subunit RsxE -
BAU10_09685 2157712..2158353 + 642 ANP65250 endonuclease III -
BAU10_09690 2158386..2158802 + 417 ANP65251 lactoylglutathione lyase -
BAU10_09695 2158953..2159387 + 435 ANP65252 hypothetical protein -
BAU10_09700 2159508..2160389 - 882 ANP65253 flagellar protein MotY -
BAU10_09705 2160731..2161375 + 645 ANP65254 ribonuclease T -
BAU10_09710 2161404..2162729 + 1326 ANP65255 sodium:proton antiporter -
BAU10_09715 2162807..2163436 - 630 ANP65256 thioredoxin -
BAU10_09720 2163573..2164148 - 576 ANP65257 hypothetical protein -
BAU10_09725 2164342..2164917 - 576 ANP65258 hypothetical protein -
BAU10_09730 2165335..2165667 - 333 ANP65259 monothiol glutaredoxin, Grx4 family -
BAU10_09735 2165952..2166536 + 585 ANP65260 superoxide dismutase -
BAU10_09740 2166691..2167194 + 504 ANP65261 hypothetical protein -
BAU10_09745 2167329..2168072 + 744 ANP65262 short-chain dehydrogenase -
BAU10_09750 2168217..2170919 - 2703 ANP65263 bifunctional acetaldehyde-CoA/alcohol dehydrogenase -
BAU10_09755 2171570..2172208 + 639 ANP65264 hypothetical protein -
BAU10_09760 2172259..2173107 + 849 ANP66484 ion transporter -
BAU10_09765 2173165..2174280 - 1116 ANP65265 aspartate-semialdehyde dehydrogenase -
BAU10_09770 2174712..2176145 + 1434 ANP65266 Na+/H+ antiporter NhaC -
BAU10_09775 2176236..2177399 - 1164 ANP65267 chemotaxis protein -
BAU10_09780 2177504..2178808 - 1305 ANP66485 histidine phosphotransferase -
BAU10_09785 2178915..2179913 - 999 ANP65268 nucleoid-associated protein YejK -
BAU10_09790 2179999..2180226 + 228 ANP65269 hypothetical protein -
BAU10_09795 2180249..2182057 + 1809 ANP65270 hydrolase -
BAU10_09805 2182498..2183421 - 924 ANP65271 histone deacetylase -
BAU10_09810 2183693..2184382 + 690 ANP65272 short-chain dehydrogenase -
BAU10_09815 2184566..2184772 + 207 ANP65273 hypothetical protein -
BAU10_09820 2184817..2186784 - 1968 ANP65274 DNA topoisomerase III -
BAU10_09825 2186888..2187436 - 549 ANP65275 nitroreductase -
BAU10_09830 2187610..2188926 + 1317 ANP65276 MFS transporter -
BAU10_09835 2188986..2190998 - 2013 ANP65277 NADPH-dependent 2,4-dienoyl-CoA reductase -
BAU10_09840 2191223..2193073 + 1851 ANP65278 signal peptide peptidase SppA -
BAU10_09845 2193238..2194251 + 1014 ANP65279 L-asparaginase 1 -
BAU10_09850 2194347..2194631 - 285 ANP65280 hypothetical protein -
BAU10_09855 2194733..2195554 + 822 ANP65281 hypothetical protein -
BAU10_09860 2195673..2196080 - 408 ANP65282 peptide-methionine (R)-S-oxide reductase -
BAU10_09865 2196418..2197413 + 996 ANP65283 type I glyceraldehyde-3-phosphate dehydrogenase -
BAU10_09870 2197570..2198454 + 885 ANP65284 D-hexose-6-phosphate mutarotase -
BAU10_09875 2198653..2200689 + 2037 ANP65285 chemotaxis protein -
BAU10_09880 2200786..2201613 + 828 ANP65286 23S rRNA (guanine(745)-N(1))-methyltransferase -
BAU10_09885 2201712..2202659 + 948 ANP65287 hypothetical protein -
BAU10_09890 2202911..2203270 + 360 ANP65288 hypothetical protein -
BAU10_09895 2203669..2205246 + 1578 ANP65289 alkaline phosphatase -
BAU10_09900 2205383..2205682 + 300 ANP65290 aryl-sulfate sulfotransferase -
BAU10_09905 2205823..2206218 + 396 ANP65291 lactoylglutathione lyase -
BAU10_09910 2206236..2206520 + 285 ANP65292 antibiotic biosynthesis monooxygenase -
BAU10_09915 2206596..2208275 - 1680 ANP65293 mechanosensitive ion channel protein MscS -
BAU10_09920 2208467..2208907 - 441 ANP65294 hypothetical protein -
BAU10_09925 2209096..2209344 + 249 ANP65295 hypothetical protein -
BAU10_09930 2209959..2210657 + 699 ANP65296 aquaporin Z -
BAU10_09935 2210709..2211308 - 600 ANP65297 recombination protein RecR -
BAU10_09940 2211339..2211668 - 330 ANP65298 nucleoid-associated protein -
BAU10_09945 2211751..2213856 - 2106 ANP65299 DNA polymerase III subunit gamma/tau -
BAU10_09950 2213865..2214410 - 546 ANP65300 adenine phosphoribosyltransferase -
BAU10_09955 2214573..2214920 - 348 ANP65301 hypothetical protein -
BAU10_09960 2215348..2216454 - 1107 ANP65302 two-component system response regulator -
BAU10_09965 2216744..2217619 + 876 ANP65303 LysR family transcriptional regulator -
BAU10_09970 2217685..2219199 - 1515 ANP65304 amidophosphoribosyltransferase -
BAU10_09975 2219236..2219727 - 492 ANP65305 bacteriocin production protein -
BAU10_09980 2219789..2220382 - 594 ANP65306 cell division protein DedD -
BAU10_09985 2220397..2221659 - 1263 ANP65307 bifunctional folylpolyglutamate synthase/dihydrofolate synthase -
BAU10_09990 2221706..2222632 - 927 ANP65308 acetyl-CoA carboxylase subunit beta -
BAU10_09995 2222830..2223624 - 795 ANP65309 tRNA pseudouridine(38,39,40) synthase TruA -
BAU10_10000 2223767..2227918 - 4152 ANP65310 AAA family ATPase -
BAU10_10005 2228116..2229129 - 1014 ANP65311 aspartate-semialdehyde dehydrogenase -
BAU10_10010 2229126..2230259 - 1134 ANP65312 4-phosphoerythronate dehydrogenase -
BAU10_10015 2230325..2230603 + 279 ANP65313 erythronate-4-phosphate dehydrogenase -
BAU10_10020 2230600..2231811 - 1212 ANP65314 beta-ketoacyl-[acyl-carrier-protein] synthase I -
BAU10_10025 2231940..2233958 + 2019 ANP65315 bifunctional tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase MnmD/FAD-dependent cmnm(5)s(2)U34 oxidoreductase MnmC -
BAU10_10030 2234035..2234559 - 525 ANP65316 NADPH-dependent FMN reductase -
BAU10_10035 2234706..2234969 - 264 ANP65317 hypothetical protein -
BAU10_10040 2234995..2235525 - 531 ANP65318 elongation factor P hydroxylase -
BAU10_10045 2235858..2236481 + 624 ANP65319 hypothetical protein -
BAU10_10050 2236705..2237790 - 1086 ANP65320 chorismate synthase -
BAU10_10055 2237971..2238903 - 933 ANP65321 ribosomal protein L3 N(5)-glutamine methyltransferase -
BAU10_10060 2238966..2239496 + 531 ANP65322 hypothetical protein -
BAU10_10065 2239593..2240057 - 465 ANP65323 phosphohistidine phosphatase SixA -
BAU10_10070 2240432..2243209 + 2778 ANP65324 peptidase M16 -
BAU10_10075 2243376..2243630 + 255 ANP65325 CG2 omega domain protein -
BAU10_10080 2243693..2245804 - 2112 ANP65326 multifunctional fatty acid oxidation complex subunit alpha -
BAU10_10085 2245804..2247111 - 1308 ANP65327 3-ketoacyl-CoA thiolase -
BAU10_10090 2247403..2247633 - 231 ANP65328 acetyl-CoA acetyltransferase -
BAU10_10095 2247832..2248407 + 576 ANP65329 RNA polymerase subunit sigma -
BAU10_10100 2248400..2249131 + 732 ANP65330 chemotaxis protein -
BAU10_10105 2249429..2250706 + 1278 ANP65331 long-chain fatty acid transporter -
BAU10_10110 2251016..2252332 + 1317 ANP65332 aromatic hydrocarbon degradation protein -
BAU10_10115 2252407..2253192 - 786 ANP65333 ABC transporter -
BAU10_10120 2253397..2254611 - 1215 ANP65334 c-type cytochrome biogenesis protein CcmI -
BAU10_10125 2254611..2255096 - 486 ANP65335 cystathionine gamma-synthase -
BAU10_10130 2255093..2255647 - 555 ANP65336 thiol:disulfide interchange protein -
BAU10_10135 2255649..2257625 - 1977 ANP65337 c-type cytochrome biogenesis protein CcmF -
BAU10_10140 2257622..2258107 - 486 ANP65338 cytochrome c biogenesis protein CcmE -
BAU10_10145 2258104..2258310 - 207 ANP65339 heme exporter protein CcmD -
BAU10_10150 2258322..2259065 - 744 ANP65340 heme ABC transporter permease -
BAU10_10155 2259175..2259843 - 669 ANP65341 heme exporter protein CcmB -
BAU10_10160 2259845..2260462 - 618 ANP65342 heme ABC transporter ATP-binding protein CcmA -
BAU10_10165 2260752..2261246 - 495 ANP66486 DNA repair protein -
BAU10_10170 2261260..2261754 - 495 ANP65343 chemotaxis protein CheW -
BAU10_10175 2261790..2262842 - 1053 ANP65344 chemotaxis protein CheW -
BAU10_10180 2262832..2263611 - 780 ANP65345 cobalamin biosynthesis protein CobQ -
BAU10_10185 2263620..2264732 - 1113 ANP65346 chemotaxis response regulator protein-glutamate methylesterase -
BAU10_10190 2264762..2267002 - 2241 ANP65347 chemotaxis protein CheA -
BAU10_10195 2267012..2267752 - 741 ANP65348 protein phosphatase -
BAU10_10200 2267871..2268239 - 369 ANP65349 histidine kinase -
BAU10_10205 2268285..2269019 - 735 ANP65350 RNA polymerase sigma factor FliA -
BAU10_10210 2269012..2269899 - 888 ANP65351 cobyrinic acid a,c-diamide synthase -
BAU10_10215 2269914..2271431 - 1518 ANP65352 flagellar biosynthesis protein FlhF -
BAU10_10220 2271460..2273559 - 2100 ANP66487 flagellar biosynthesis protein FlhA -
BAU10_10225 2273770..2274900 - 1131 ANP65353 flagellar biosynthesis protein FlhB -
BAU10_10230 2274904..2275686 - 783 ANP65354 flagellar biosynthetic protein FliR -
BAU10_10235 2275695..2275964 - 270 ANP65355 flagellar export apparatus protein FliQ -
BAU10_10240 2275989..2276858 - 870 ANP65356 flagellar biosynthetic protein FliP -
BAU10_10245 2276845..2277258 - 414 ANP65357 flagellar biosynthetic protein FliO -
BAU10_10250 2277260..2277670 - 411 ANP65358 flagellar motor switch protein FliN -
BAU10_10255 2277729..2278775 - 1047 ANP65359 flagellar motor switch protein FliM -
BAU10_10260 2278783..2279286 - 504 ANP65360 flagellar basal body-associated protein FliL -
BAU10_10265 2279372..2281225 - 1854 ANP65361 flagellar hook-length control protein FliK -
BAU10_10270 2281506..2281820 + 315 ANP65362 hypothetical protein -
BAU10_10275 2281861..2282304 - 444 ANP65363 flagellar protein FliJ -
BAU10_10280 2282311..2283630 - 1320 ANP65364 flagellar protein export ATPase FliI -
BAU10_10285 2283634..2284434 - 801 ANP65365 flagellar assembly protein FliH -
BAU10_10290 2284506..2285561 - 1056 ANP65366 flagellar motor switch protein FliG -
BAU10_10295 2285554..2287302 - 1749 ANP65367 flagellar M-ring protein FliF -
BAU10_10300 2287311..2287622 - 312 ANP66488 flagellar hook-basal body complex protein FliE -
BAU10_10305 2287745..2289154 - 1410 ANP65368 sigma-54-dependent Fis family transcriptional regulator -
BAU10_10310 2289191..2290222 - 1032 ANP65369 PAS domain-containing sensor histidine kinase -
BAU10_10315 2290422..2291888 - 1467 ANP65370 sigma-54-dependent Fis family transcriptional regulator -
BAU10_10320 2292176..2292586 - 411 ANP65371 flagellar export chaperone FliS -
BAU10_10325 2292599..2292904 - 306 ANP65372 flagellar rod protein FlaI -
BAU10_10330 2292908..2294902 - 1995 ANP65373 flagellar filament capping protein FliD -
BAU10_10335 2294924..2295358 - 435 ANP65374 flagellar biosynthesis protein FlaG -
BAU10_10340 2295451..2296581 - 1131 ANP65375 flagellin B -
BAU10_10345 2296870..2298003 - 1134 ANP65376 flagellin -
BAU10_10350 2298266..2299405 - 1140 ANP65377 flagellin -
BAU10_10355 2299549..2300451 - 903 ANP65378 deferrochelatase -
BAU10_10360 2300498..2300983 - 486 ANP66489 hypothetical protein -
BAU10_10365 2301128..2301481 + 354 ANP65379 hypothetical protein -
BAU10_10370 2301485..2301817 + 333 ANP65380 hypothetical protein -
BAU10_10375 2301852..2302139 - 288 ANP65381 hypothetical protein -
BAU10_10380 2302431..2302781 + 351 ANP65382 arsenate reductase -
BAU10_10385 2302800..2303936 + 1137 ANP65383 succinyl-diaminopimelate desuccinylase -
BAU10_10390 2303951..2304649 + 699 ANP65384 peptidase M15 -
BAU10_10395 2304646..2304849 + 204 ANP65385 DUF2897 domain-containing protein -
BAU10_10400 2304956..2305975 - 1020 ANP65386 outer membrane assembly protein BamC -
BAU10_10405 2306056..2306934 - 879 ANP65387 4-hydroxy-tetrahydrodipicolinate synthase -
BAU10_10410 2307410..2307952 + 543 ANP65388 glycine cleavage system transcriptional repressor -
BAU10_10415 2307969..2308439 + 471 ANP65389 thioredoxin-dependent thiol peroxidase -
BAU10_10420 2308517..2309590 - 1074 ANP65390 AI-2E family transporter -
BAU10_10425 2309592..2309828 - 237 ANP65391 sirA-like family protein -
BAU10_10430 2310086..2311537 + 1452 ANP65392 hypothetical protein -
BAU10_10435 2311554..2311904 + 351 ANP65393 arsenate reductase (glutaredoxin) -
BAU10_10440 2311905..2312474 + 570 ANP65394 NAD(P)H:quinone oxidoreductase, type IV -
BAU10_10445 2312497..2312937 + 441 ANP65395 hypothetical protein -
BAU10_10450 2313078..2314286 - 1209 ANP65396 hypothetical protein -
BAU10_10455 2314652..2315905 + 1254 ANP65397 uracil permease -
BAU10_10460 2316022..2316648 - 627 ANP65398 uracil phosphoribosyltransferase -
BAU10_10465 2316828..2317868 + 1041 ANP65399 phosphoribosylformylglycinamidine cyclo-ligase -
BAU10_10470 2318020..2318676 + 657 ANP65400 phosphoribosylglycinamide formyltransferase -
BAU10_10475 2319066..2319911 - 846 ANP65401 class II glutamine amidotransferase -
BAU10_10480 2319963..2320538 - 576 ANP65402 phosphoheptose isomerase -
BAU10_10485 2320915..2323359 + 2445 ANP65403 acyl-CoA dehydrogenase -
BAU10_10490 2323564..2325339 + 1776 ANP65404 sulfate permease -
BAU10_10495 2325413..2325823 - 411 ANP65405 GCN5 family acetyltransferase -
BAU10_10500 2325908..2326300 - 393 ANP65406 hypothetical protein -
BAU10_10505 2326492..2327010 - 519 ANP65407 hypothetical protein -
BAU10_10510 2327234..2328484 - 1251 ANP65408 TIGR03503 family protein -
BAU10_10515 2328493..2329215 - 723 ANP65409 DNA polymerase III subunit epsilon -
BAU10_10520 2329275..2329739 + 465 ANP65410 ribonuclease HI -
BAU10_10525 2329736..2330482 - 747 ANP65411 SAM-dependent methyltransferase -
BAU10_10530 2330520..2331278 + 759 ANP66490 hydroxyacylglutathione hydrolase -
BAU10_10535 2331533..2333116 + 1584 ANP65412 lytic transglycosylase -
BAU10_10540 2333113..2333799 + 687 ANP65413 hypothetical protein -
BAU10_10545 2333801..2334646 - 846 ANP65414 hypothetical protein -
BAU10_10550 2334787..2335125 - 339 ANP65415 transcriptional regulator -
BAU10_10555 2335312..2335626 - 315 ANP65416 cytochrome C biogenesis protein CcsB -
BAU10_10560 2335697..2337007 - 1311 ANP65417 tRNA lysidine(34) synthetase TilS -
BAU10_10565 2337114..2338073 - 960 ANP65418 acetyl-CoA carboxylase carboxyltransferase subunit alpha -
BAU10_10570 2338120..2341599 - 3480 ANP65419 DNA polymerase III subunit alpha -
BAU10_10575 2341681..2342316 - 636 ANP65420 ribonuclease HII -
BAU10_10580 2342326..2343465 - 1140 ANP65421 lipid-A-disaccharide synthase -
BAU10_10585 2343585..2344373 - 789 ANP65422 acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase -
BAU10_10590 2344375..2344827 - 453 ANP65423 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ -
BAU10_10595 2345060..2346091 - 1032 ANP65424 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase -
BAU10_10600 2346098..2346607 - 510 ANP66491 molecular chaperone -
BAU10_10605 2346621..2349035 - 2415 ANP65425 outer membrane protein assembly factor BamA -
BAU10_10610 2349080..2350438 - 1359 ANP65426 RIP metalloprotease RseP -
BAU10_10615 2350438..2351643 - 1206 ANP65427 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
BAU10_10620 2351694..2352536 - 843 ANP65428 CDP-diglyceride synthetase -
BAU10_10625 2352549..2353304 - 756 ANP65429 di-trans,poly-cis-decaprenylcistransferase -
BAU10_10630 2353401..2353958 - 558 ANP65430 ribosome recycling factor -
BAU10_10635 2354059..2354784 - 726 ANP65431 UMP kinase -
BAU10_10640 2354932..2355777 - 846 ANP65432 translation elongation factor Ts -
BAU10_10645 2355910..2356638 - 729 ANP65433 30S ribosomal protein S2 -
BAU10_10650 2357023..2357901 + 879 ANP65434 type I methionyl aminopeptidase -
BAU10_10655 2358010..2360634 + 2625 ANP65435 [protein-PII] uridylyltransferase -
BAU10_10660 2360777..2361160 + 384 ANP65436 hypothetical protein -
BAU10_10665 2361228..2362010 - 783 ANP65437 tRNA pseudouridine(65) synthase TruC -
BAU10_10670 2362015..2362329 - 315 ANP66492 hypothetical protein -
BAU10_10675 2362406..2363443 + 1038 ANP65438 hypothetical protein -
BAU10_10680 2363457..2363756 + 300 ANP65439 hypothetical protein -
BAU10_10685 2363716..2364222 - 507 ANP65440 acetyltransferase -
BAU10_10690 2365133..2365426 + 294 ANP65441 hypothetical protein -
BAU10_10695 2365423..2365872 + 450 ANP65442 hypothetical protein -
BAU10_10700 2366226..2367056 + 831 ANP66493 3-oxoacyl-ACP synthase -
BAU10_10705 2367053..2368039 + 987 ANP65443 UDP-glucose 4-epimerase -
BAU10_10710 2368008..2368871 + 864 ANP65444 polysaccharide biosynthesis protein GumP -
BAU10_10715 2368868..2370127 + 1260 ANP66494 CoF synthetase -
BAU10_10720 2370115..2371227 + 1113 ANP65445 carboxylate--amine ligase -
BAU10_10725 2371224..2372297 + 1074 ANP65446 hypothetical protein -
BAU10_10730 2372404..2373990 - 1587 ANP65447 aminobenzoyl-glutamate transporter -
BAU10_10735 2374349..2374609 - 261 ANP65448 50S ribosomal protein L31 -
BAU10_10740 2374733..2375428 + 696 ANP65449 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA -
BAU10_10745 2375540..2377255 + 1716 ANP65450 proline--tRNA ligase -
BAU10_10750 2377432..2378100 + 669 ANP65451 hypothetical protein -
BAU10_10755 2378212..2378418 + 207 ANP65452 hypothetical protein -
BAU10_10760 2378418..2378609 + 192 ANP65453 hypothetical protein -
BAU10_10765 2378714..2380078 - 1365 ANP65454 transporter -
BAU10_10770 2380457..2383003 + 2547 ANP65455 chitinase -
BAU10_10775 2383094..2383837 - 744 ANP65456 chemotaxis protein -
BAU10_10780 2383899..2384378 - 480 ANP65457 transcription elongation factor -
BAU10_10785 2384455..2386380 + 1926 ANP65458 recombinase RecQ -
BAU10_10790 2386377..2387441 - 1065 ANP66495 DNA polymerase IV -
BAU10_10795 2387518..2387751 - 234 ANP65459 hypothetical protein -
BAU10_10800 2387939..2389156 + 1218 ANP65460 diguanylate cyclase response regulator -
BAU10_10805 2389315..2389548 - 234 ANP65461 hypothetical protein -
BAU10_10810 2389571..2390575 - 1005 ANP65462 FAD:protein FMN transferase ApbE -
BAU10_10815 2390733..2391956 - 1224 ANP65463 NADH:ubiquinone reductase (Na(+)-transporting) subunit F -
BAU10_10820 2391990..2392586 - 597 ANP65464 NADH:ubiquinone reductase (Na(+)-transporting) subunit E -
BAU10_10825 2392594..2393226 - 633 ANP65465 NADH:ubiquinone reductase (Na(+)-transporting) subunit D -
BAU10_10830 2393226..2393996 - 771 ANP65466 Na(+)-translocating NADH-quinone reductase subunit C -
BAU10_10835 2393986..2395230 - 1245 ANP65467 NADH:ubiquinone reductase (Na(+)-transporting) subunit B -
BAU10_10840 2395236..2396576 - 1341 ANP66496 NADH:ubiquinone reductase (Na(+)-transporting) subunit A -
BAU10_10845 2397050..2397358 - 309 ANP65468 transcriptional regulator BolA -
BAU10_10850 2397602..2398756 + 1155 ANP65469 50S rRNA methyltransferase -
BAU10_10855 2398789..2399358 + 570 ANP65470 hypothetical protein -
BAU10_10860 2399358..2399903 + 546 ANP65471 peptidyl-prolyl cis-trans isomerase -
BAU10_10865 2399975..2401327 + 1353 ANP65472 MFS transporter -
BAU10_10870 2401391..2402050 - 660 ANP65473 transcriptional regulator -
BAU10_10875 2402047..2402631 - 585 ANP65474 RNA polymerase subunit sigma -
BAU10_10880 2402676..2404034 - 1359 ANP65475 2-dehydropantoate 2-reductase -
BAU10_10885 2404031..2404627 - 597 ANP65476 ATP-dependent protease -
BAU10_10890 2404951..2405748 + 798 ANP65477 hypothetical protein -
BAU10_10895 2405857..2406747 + 891 ANP65478 2-dehydropantoate 2-reductase -
BAU10_10900 2406744..2407343 + 600 ANP65479 oxidative-stress-resistance chaperone -
BAU10_10905 2407343..2408554 + 1212 ANP65480 cysteine sulfinate desulfinase -
BAU10_10910 2408588..2409508 - 921 ANP65481 diguanylate cyclase -
BAU10_10915 2409818..2410246 - 429 ANP65482 cysteine desulfurase, sulfur acceptor subunit CsdE -
BAU10_10920 2410266..2411075 - 810 ANP65483 tRNA threonylcarbamoyladenosine dehydratase -
BAU10_10925 2411175..2412278 - 1104 ANP65484 murein transglycosylase A -
BAU10_10930 2412552..2413007 - 456 ANP65485 N-acetylglutamate synthase -
BAU10_10935 2413170..2414507 + 1338 ANP66497 amino-acid N-acetyltransferase -
BAU10_10940 2415161..2415532 - 372 ANP65486 hypothetical protein -
BAU10_10945 2415520..2416530 - 1011 ANP65487 peptidoglycan-binding protein LysM -
BAU10_10950 2416696..2418843 - 2148 ANP65488 exodeoxyribonuclease V subunit alpha -
BAU10_10955 2418843..2422517 - 3675 ANP66498 exodeoxyribonuclease V subunit beta -
BAU10_10960 2422625..2422810 - 186 ANP65489 hypothetical protein -
BAU10_10965 2422845..2426336 - 3492 ANP65490 exodeoxyribonuclease V subunit gamma -
BAU10_10970 2426589..2428412 + 1824 ANP65491 hydrolase -
BAU10_10975 2428488..2429462 - 975 ANP65492 C4-dicarboxylate ABC transporter -
BAU10_10980 2429572..2430498 + 927 ANP65493 XRE family transcriptional regulator -
BAU10_10985 2430627..2430926 + 300 ANP65494 multidrug DMT transporter permease -
BAU10_10990 2431418..2432110 + 693 ANP65495 hypothetical protein -
BAU10_10995 2432134..2433117 + 984 ANP65496 GGGtGRT protein -
BAU10_11000 2433443..2434474 + 1032 ANP65497 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase -
BAU10_11005 2434556..2435611 - 1056 ANP65498 glycerophosphodiester phosphodiesterase -
BAU10_11010 2435668..2437032 - 1365 ANP65499 glycerol-3-phosphate transporter -
BAU10_11015 2437929..2438783 + 855 ANP65500 aquaporin -
BAU10_11020 2438843..2440360 + 1518 ANP65501 glycerol kinase -
BAU10_11025 2440520..2441311 + 792 ANP65502 transcriptional regulator -
BAU10_11030 2441489..2443048 + 1560 ANP65503 glycerol-3-phosphate dehydrogenase -
BAU10_11035 2443325..2444278 + 954 ANP65504 magnesium transporter -
BAU10_11040 2444352..2445536 - 1185 ANP65505 short-chain dehydrogenase -
BAU10_11045 2445719..2446270 + 552 ANP65506 hypothetical protein -
BAU10_11050 2446309..2446896 - 588 ANP65507 histidine kinase -
BAU10_11055 2447317..2448303 + 987 ANP65508 transcriptional regulator EbgR -
BAU10_11060 2448474..2449391 - 918 ANP66499 LysR family transcriptional regulator -
BAU10_11065 2449504..2450643 + 1140 ANP65509 chorismate-binding protein -
BAU10_11070 2450767..2451411 - 645 ANP65510 helix-turn-helix transcriptional regulator -
BAU10_11075 2451980..2452909 + 930 ANP65511 dentin sialophosphoprotein -
BAU10_11080 2452930..2453253 + 324 ANP65512 carbon storage regulator -
BAU10_11085 2453259..2453936 + 678 ANP65513 bacteriocin resistance protein -
BAU10_11090 2453991..2454557 + 567 ANP65514 hypothetical protein -
BAU10_11095 2454782..2455777 - 996 ANP65515 hypothetical protein -
BAU10_11100 2456254..2457945 + 1692 ANP66500 AMP-dependent synthetase -
BAU10_11105 2458321..2459268 + 948 ANP65516 transcriptional regulator -
BAU10_11110 2459375..2461465 - 2091 ANP65517 translation elongation factor G -
BAU10_11115 2461681..2463060 - 1380 ANP65518 DNA repair protein RadA -
BAU10_11120 2463197..2465545 + 2349 ANP65519 pilus assembly protein PilZ -
BAU10_11125 2465609..2466589 - 981 ANP65520 phosphoserine phosphatase SerB -
BAU10_11130 2466681..2467286 + 606 ANP65521 SMP protein -
BAU10_11135 2467382..2468101 - 720 ANP65522 purine-nucleoside phosphorylase -
BAU10_11140 2468245..2469465 - 1221 ANP65523 phosphopentomutase -
BAU10_11145 2469534..2470862 - 1329 ANP65524 thymidine phosphorylase -
BAU10_11150 2470960..2471736 - 777 ANP65525 deoxyribose-phosphate aldolase -
BAU10_11155 2472320..2473603 - 1284 ANP65526 nucleoside transporter NupC -
BAU10_11160 2473808..2474581 - 774 ANP65527 deoxyribonuclease -
BAU10_11165 2474568..2474765 - 198 ANP65528 hypothetical protein -
BAU10_11170 2474860..2476449 - 1590 ANP65529 peptide chain release factor 3 -
BAU10_11175 2476706..2477353 - 648 ANP65530 transcriptional regulator -
BAU10_11180 2477471..2477722 + 252 ANP65531 Cro/Cl family transcriptional regulator -
BAU10_11185 2477778..2478647 + 870 ANP65532 hypothetical protein -
BAU10_11190 2478634..2479296 + 663 ANP65533 hypothetical protein -
BAU10_11195 2479283..2479831 + 549 ANP65534 transglycosylase -
BAU10_11200 2479828..2480127 + 300 ANP65535 transcriptional regulator -
BAU10_11205 2480124..2480657 + 534 ANP65536 transcriptional regulator -
BAU10_11210 2480712..2481143 + 432 ANP65537 hypothetical protein -
BAU10_11215 2481176..2484745 - 3570 ANP65538 conjugal transfer protein TraG -
BAU10_11220 2484749..2486137 - 1389 ANP65539 conjugal transfer protein TraH -
BAU10_11225 2486140..2487084 - 945 ANP65540 pilus assembly protein -
BAU10_11230 2487614..2488204 + 591 ANP65541 hypothetical protein -
BAU10_11235 2488380..2489369 + 990 ANP65542 hypothetical protein -
BAU10_11240 2489369..2492410 + 3042 ANP65543 hypothetical protein -
BAU10_11245 2492411..2492887 + 477 ANP65544 hypothetical protein -
BAU10_11250 2493132..2494280 + 1149 ANP65545 diguanylate cyclase -
BAU10_11255 2494449..2495156 - 708 ANP65546 hypothetical protein -
BAU10_11260 2495246..2496319 - 1074 ANP65547 DNA primase -
BAU10_11265 2496411..2496752 - 342 ANP65548 plasmid-related protein -
BAU10_11270 2496752..2497249 - 498 ANP65549 DNA repair protein RadC -
BAU10_11275 2497332..2498987 - 1656 ANP65550 hypothetical protein -
BAU10_11280 2499057..2499497 - 441 ANP65551 hypothetical protein -
BAU10_11285 2499559..2500512 - 954 ANP65552 cobalamin biosynthesis protein -
BAU10_11290 2500611..2501378 - 768 ANP65553 hypothetical protein -
BAU10_11295 2501378..2502337 - 960 ANP65554 ATPase -
BAU10_11300 2502547..2503563 - 1017 ANP65555 endonuclease -
BAU10_11305 2503849..2504667 - 819 ANP65556 phage recombination protein Bet -
BAU10_11310 2504747..2505166 - 420 ANP65557 single-stranded DNA-binding protein -
BAU10_11315 2505182..2505508 - 327 ANP65558 plasmid-related protein -
BAU10_11320 2505876..2506478 + 603 ANP65559 hypothetical protein -
BAU10_11325 2506569..2507231 - 663 ANP65560 hypothetical protein -
BAU10_11330 2507262..2507585 - 324 ANP66501 hypothetical protein -
BAU10_11335 2507644..2508063 - 420 ANP66502 S26 family signal peptidase -
BAU10_11340 2508140..2508487 - 348 ANP65561 plasmid-related protein -
BAU10_11345 2508617..2509720 + 1104 ANP65562 transposase -
BAU10_11350 2509783..2512194 - 2412 ANP65563 type-IV secretion system protein TraC virb4
BAU10_11355 2512194..2512886 - 693 ANP65564 disulfide isomerase trbB
BAU10_11360 2513018..2513956 - 939 ANP65565 hypothetical protein -
BAU10_11365 2513949..2514740 - 792 ANP66503 hypothetical protein -
BAU10_11370 2514960..2515346 - 387 ANP65566 hypothetical protein -
BAU10_11375 2515343..2515993 - 651 ANP65567 conjugal transfer protein TraV traV
BAU10_11380 2515990..2517279 - 1290 ANP65568 conjugal transfer protein TraB traB
BAU10_11385 2517286..2518179 - 894 ANP66504 hypothetical protein traK
BAU10_11390 2518163..2518789 - 627 ANP65569 pilus assembly protein traE
BAU10_11395 2518786..2519067 - 282 ANP65570 type IV conjugative transfer system protein TraL traL
BAU10_11400 2519222..2520427 - 1206 ANP65571 transposase -
BAU10_11405 2520503..2521609 - 1107 ANP65572 zinc peptidase -
BAU10_11410 2521602..2522186 - 585 ANP65573 hypothetical protein -
BAU10_11415 2522312..2522947 - 636 ANP65574 conjugal transfer protein tfc7
BAU10_11420 2522934..2523494 - 561 ANP65575 conjugative transfer protein -
BAU10_11425 2523504..2525324 - 1821 ANP65576 conjugal transfer protein virb4
BAU10_11430 2525373..2527523 - 2151 ANP65577 phosphohydrolase -
BAU10_11435 2527680..2528861 - 1182 ANP65578 hypothetical protein -

Host bacterium

ID   355 Element type   ICE (Integrative and conjugative element)
Element name   ICEValZJT1 GenBank   CP016224
Element size   3535128 bp Coordinate of oriT [Strand]   84579..84877 [-]
Host bacterium   Vibrio alginolyticus strain ZJ-T Coordinate of element   2476706..2564476

Cargo genes

Drug resistance gene   sul2, aph(3'')-Ib, aph(6)-Id, dfrA31, qnrVC5
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -