Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200378
Name   oriT_ICEPmiChn-JZ35 in_silico
Organism   Proteus terrae subsp. cibarius strain JZ35 ICEPmiChn-JZ35 mobile element
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   ON390821 (112639..112935 [-], 297 nt)
oriT length   297 nt
IRs (inverted repeats)      232..240, 252..260  (AAAGCCAAA..TTTGGCTTT)
 44..49, 51..56  (CAAACG..CGTTTG)
 7..12, 26..31  (TTTGGC..GCCAAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 297 nt

>oriT_ICEPmiChn-JZ35
GCTCTGTTTGGCGGCTGGTGACCTAGCCAAAAAATTGAGACGCCAAACGTCGTTTGCATTCTGGCCTGAACTTGCCAAACGGTTTGTATCTTCATGGCGATACGTCTTTTAGGTGTTTTTAAGTGAAATCAGCCTGTATCCCTTGTCGGGTATGGGATTGAGCGAGTCGATTTATATCGAGACGCCAAACAGTGATTGTGACGGCAGTTTTACGTTTGGCGTTTCGATCCAAAAGCCAAACGGATAGTGGTTTTGGCTTTAGGGGTTAATTGGATGGGGAAATTGGTTTGGTAGAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14404 GenBank   UVX22906
Name   TraI_2_-_ICEPmiChn-JZ35 insolico UniProt ID   _
Length   420 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 420 a.a.        Molecular weight: 46272.70 Da        Isoelectric Point: 4.9651

>UVX22906.1 hypothetical protein [Proteus terrae subsp. cibarius]
MLEAIGNTDPEHVLSKLVIEADQTSVQRDLKAQRISVDDNALGVPVERYLLDAMRRLLASSQWLVNQRDA
RVWVRKSNQSTNLYLVWKSAAKDIIELLAKDKIPGIPRDPDTLADILIERGLATKSASNERYESLAPEVL
IKDGKPIWLPMLHMSEADLLFSSNVPSGVTLFSKSEWEATQQTQAEPQSRSSEHPDLPEASSSIEHSNSA
ESPSTKPSDQDDELRHASDVNHLQANENVPGDGCEKPNNSYDGAISNNVNQHDAEALNLPESLTWLTEAS
NALVIVGEQILIRYPDAVRPWCAPRKLLAELSRLDWLELDPANPTRKARTVTTNDGVQEQGLLLKVSISK
GLTALIDISKHDTESAAAIQNEEALPRPSRTETTNAQAKNRHKNGAKAKADCGQCELKYRPQTRAAATDG

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(6-126)


  Protein structure



No available structure.




T4CP

ID   16918 GenBank   UVX22904
Name   t4cp1_-_ICEPmiChn-JZ35 insolico UniProt ID   _
Length   323 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 323 a.a.        Molecular weight: 36220.82 Da        Isoelectric Point: 9.5880

>UVX22904.1 IncF plasmid conjugative transfer protein TraD [Proteus terrae subsp. cibarius]
MKENAYEMPWRTNYEAMAAAGWLVGATGAIAAEMLTELPPEPFWWMTGISSGMALYRLPEAYRLYKLQKG
LKGKPLAFMELSHLQKVMAKHPDELWLGYGFEWDQRHAQRAYEILKRDKQTLLNQGHGKQMGSTWIHGVE
PKEEDVYQPVGHTEGHTLIVGTTGAGKTRCFDAMITQAILRNEAVIIIDPKGDKELKDNTQRACIAAGSP
ERFVYFHPGFPEHSVRLNPLRNFNRGTEIASRIAALIPSETGADPFKAFGQMALNNIVQGLLLTSQRPDL
KTLRRFLEGGPEGLVVKAVTAWGSRCIRTLVWRLSALPKRPTP

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(152-278)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 35573..55417

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Locus_46 30976..31998 - 1023 UVX22870 hypothetical protein -
Locus_47 32090..32515 - 426 UVX22871 hypothetical protein -
Locus_48 32920..33222 - 303 UVX22872 Dihydropteroate synthase type-2 -
Locus_49 33219..33815 - 597 UVX22873 Dihydropteroate synthase type-2 -
Locus_50 34262..35080 - 819 UVX22874 Aminoglycoside 3''-nucleotidyltransferase ANT(3'')-Ia (AadA family) -
Locus_51 35573..36100 - 528 UVX22875 IncF plasmid conjugative transfer protein TraN traN
Locus_52 36109..36237 - 129 UVX22876 IncF plasmid conjugative transfer protein TraN -
Locus_53 36254..36526 - 273 UVX22877 IncF plasmid conjugative transfer protein TraN -
Locus_54 36526..39261 - 2736 UVX22878 hypothetical protein traN
Locus_55 39264..39482 - 219 UVX22879 IncF plasmid conjugative transfer pilus assembly protein TraU traU
Locus_56 39569..40291 - 723 UVX22880 IncF plasmid conjugative transfer pilus assembly protein TraU traU
Locus_57 40275..40688 - 414 UVX22881 IncF plasmid conjugative transfer pilus assembly protein TraW traW
Locus_58 40691..41401 - 711 UVX22882 hypothetical protein trbC
Locus_59 41409..41921 - 513 UVX22883 Conjugative signal peptidase TrhF -
Locus_60 41905..42252 - 348 UVX22884 Conjugative transfer protein 345 -
Locus_61 42245..42490 - 246 UVX22885 IncF plasmid conjugative transfer pilus assembly protein TraC virb4
Locus_62 42481..42990 - 510 UVX22886 IncF plasmid conjugative transfer pilus assembly protein TraC virb4
Locus_63 42984..43652 - 669 UVX22887 IncF plasmid conjugative transfer pilus assembly protein TraC virb4
Locus_64 43649..44641 - 993 UVX22888 hypothetical protein virb4
Locus_65 44641..44997 - 357 UVX22889 hypothetical protein trbB
Locus_66 44952..45332 - 381 UVX22890 Thiol:disulfide involved in conjugative transfer -
Locus_67 45464..45706 - 243 UVX22891 Ync -
Locus_68 45845..46399 - 555 UVX22892 Ync -
Locus_69 46392..47225 - 834 UVX22893 Ynd -
Locus_70 47403..47789 - 387 UVX22894 Conjugative transfer protein TraA -
Locus_71 47786..49720 - 1935 UVX22895 IncF plasmid conjugative transfer pilus assembly protein TraB traB
Locus_72 49723..50622 - 900 UVX22896 hypothetical protein traK
Locus_73 50603..51229 - 627 UVX22897 IncF plasmid conjugative transfer pilus assembly protein TraE traE
Locus_74 51226..51507 - 282 UVX22898 IncF plasmid conjugative transfer pilus assembly protein TraL traL
Locus_75 51793..52380 + 588 UVX22899 hypothetical protein -
Locus_76 52407..52673 - 267 UVX22900 Conjugative transfer protein s043 -
Locus_77 52673..53041 - 369 UVX22901 Conjugative transfer protein s043 -
Locus_78 53028..53588 - 561 UVX22902 Conjugative transfer protein 234 -
Locus_79 53598..54485 - 888 UVX22903 IncF plasmid conjugative transfer protein TraD virb4
Locus_80 54446..55417 - 972 UVX22904 IncF plasmid conjugative transfer protein TraD virb4
Locus_81 55456..55689 - 234 UVX22905 Conjugative transfer protein TraI relaxase -
Locus_82 55682..56944 - 1263 UVX22906 hypothetical protein -
Locus_83 57230..57625 - 396 UVX22907 Conjugative transfer protein TraI relaxase -

Host bacterium

ID   335 Element type   ICE (Integrative and conjugative element)
Element name   ICEPmiChn-JZ35 GenBank   ON390821
Element size   142200 bp Coordinate of oriT [Strand]   112639..112935 [-]
Host bacterium   Proteus terrae subsp. cibarius strain JZ35 ICEPmiChn-JZ35 mobile element Coordinate of element   1..142200

Cargo genes

Drug resistance gene   aadA2, dfrA19, sul1, qacE, sul2, aph(3'')-Ib, aph(6)-Id, aph(3')-VIa, floR, tet(X6)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -