Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200352
Name   oriT_ICEBfrQ1F2-1 in_silico
Organism   Bacteroides fragilis strain Q1F2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   CP018937 (33719..33918 [-], 200 nt)
oriT length   200 nt
IRs (inverted repeats)      13..20, 23..30  (TATGTTCA..TGAACATA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 200 nt

>oriT_ICEBfrQ1F2-1
CCGACGGATTTTTATGTTCACCTGAACATAGCAAGATGTCTTTTCAGCCGCTCAAAATATTTTGAGCAGCCACGAAAAGCACTTGCCCTTGCAGGGGGCGGGCTTTCCCTCCGAAGTCGGGAAGCCTTTCAGAACTGCGGTGCTGTAATCCGAAGCGGCGGCTTATGCCGTCAATCCGCTAAATCCAAAGTAATATGAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14378 GenBank   AUI47413
Name   Relaxase_BUN20_13045_ICEBfrQ1F2-1 insolico UniProt ID   _
Length   415 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 415 a.a.        Molecular weight: 46563.08 Da        Isoelectric Point: 9.8931

>AUI47413.1 relaxase [Bacteroides fragilis]
MVAKISVGSSLYGAIAYNGEKINEAQGRLLTTNRIYNDGSGTVDIGKAMEGFLTFLPPQMKIEKPVVHIS
LNPHPEDVLTDIELQNIAREYLEKLGFGNQPYLVFKHEDIDRHHLHIVTVNVDENGKRLNRDFLYRRSDR
IRRELEQKYGLHPAERKNQRLDNPLRKVAASAGDVKKQVGNTVKALNGQYRFQTMGEYRALLSLYNMTVE
EARGNVRGREYHGLVYSVTDDKGNKVGNPFKSSLFGKSAGYEAVQKKFVRSKSEIKDRKLADMTKRTVLS
VLQGTYDKDKFVSQLKEKGIDTVLRYTEEGRIYGATFIDHRTGCVLNGSRMGKELSANALQEHFTLPYAG
QPPIPLSIPVDAADKAHGQTAYDSEDISGGMGLLTPEGPAVDAEEEAFIRAMKRKKKKKRKGLGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(64-184)


  Protein structure



No available structure.




T4CP

ID   16873 GenBank   AUI47412
Name   t4cp2_BUN20_13040_ICEBfrQ1F2-1 insolico UniProt ID   _
Length   672 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 672 a.a.        Molecular weight: 77086.10 Da        Isoelectric Point: 7.1001

>AUI47412.1 conjugal transfer protein TraG [Bacteroides fragilis]
MSQQEDDLRALAKIMDFLRAVSIILVVMNVYWFCYEAIRLWGVNIGVVDKILLNFDRTAGLFHSILYTKL
FSVLLLALSCLGTKGVKGEKITWGRIWTAFAVGFVLFFLNWWLLPLPLPLEAVTGLYVLTIGTGYVCLLM
GGLWMSRLLKHNLMEDVFNNENESFMQETRLIESEYSVNLPTRFYYRKRWNNGWINVVNPFRASIVLGTP
GSGKSYAVVNNFIKQQIEKGFSQYIYDFKYPDLSTIAYNHLLNHPDGYKVKPKFYVINFDDPRRSHRCNP
IHPDFMEDITDAYESAYTIMLNLNKTWVQKQGDFFVESPIILFASIIWYLKIYQNGKFCTFPHAIEFLNR
RYEDIFPILTSYPELENYLSPFMDAWLGGAAEQLMGQIASAKIPLSRMISPQLYWVMSDSEFTLDINNPE
EPKILCVGNNPDRQNIYGAALGLYNSRIVKLINKKGMLKSSVIIDELPTIYFKGLDNLIATARSNKVAVC
LGFQDFSQLVRDYGDKEAKVVMNTVGNIFSGQVVGETAKTLSERFGKVLQKRQSISINRQDVSTSINTQM
DALIPPSKISGLTQGMFVGSVSDNFNERIEQKIFHCEIVVDAEKVKREESAYKKIPVITNFTDEDGNDRM
KETVQANYRRIKEEVKQIVQEELERIKNDPVLCKLLPDNETV

  Protein domains


Predicted by InterproScan.

YWFCY protein (YWFCY)

(6-150)

TraM recognition site of TraD and TraG (TraG-D_C)

(462-572)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2990594..3003751

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BUN20_13045 2985723..2986970 - 1248 AUI47413 relaxase -
BUN20_13050 2986949..2987377 - 429 AUI47414 MobA protein -
BUN20_13055 2987647..2987826 - 180 AUI49222 hypothetical protein -
BUN20_13060 2987919..2988111 + 193 Protein_2571 hypothetical protein -
BUN20_13065 2988059..2988814 + 756 AUI47415 conjugal transfer protein TraA -
BUN20_13070 2988820..2989269 + 450 AUI47416 conjugal transfer protein TraB -
BUN20_13075 2989293..2989655 + 363 AUI47417 conjugal transfer protein TraC -
BUN20_13080 2989652..2990392 + 741 AUI47418 conjugal transfer protein TraD -
BUN20_13085 2990396..2990614 - 219 Protein_2576 hypothetical protein -
BUN20_13090 2990594..2990905 + 312 AUI47419 conjugal transfer protein TraE traE
BUN20_13095 2990916..2991248 + 333 AUI47420 conjugal transfer protein TraF traF
BUN20_13100 2991245..2993749 + 2505 AUI47421 conjugal transfer protein TraG virb4
BUN20_13105 2993787..2994170 + 384 AUI49223 conjugal transfer protein TraH traH
BUN20_13110 2994201..2994830 + 630 AUI47422 hypothetical protein traI
BUN20_13115 2994834..2995838 + 1005 AUI47423 conjugative transposon protein TraJ traJ
BUN20_13120 2995870..2996493 + 624 AUI47424 conjugative transposon protein TraK traK
BUN20_13125 2996500..2996808 + 309 AUI47425 conjugal transfer protein TraL traL
BUN20_13130 2996789..2998144 + 1356 AUI47426 conjugative transposon protein TraM traM
BUN20_13135 2998214..2998711 + 498 AUI47427 conjugal transfer protein TraN traN
BUN20_13140 2998730..2999217 + 488 Protein_2587 hypothetical protein -
BUN20_13145 2999252..3001063 + 1812 AUI47428 group II intron reverse transcriptase/maturase -
BUN20_13150 3001035..3001759 + 725 Protein_2589 conjugative transposon protein TraN -
BUN20_13155 3001762..3002337 + 576 AUI47429 conjugal transfer protein TraO traO
BUN20_13160 3002346..3003245 + 900 AUI47430 DNA primase traP
BUN20_13165 3003245..3003751 + 507 AUI47431 conjugal transfer protein TraQ traQ
BUN20_13170 3003748..3004275 + 528 AUI47432 lysozyme -
BUN20_13175 3004338..3004559 - 222 AUI47433 hypothetical protein -
BUN20_13180 3004676..3004984 - 309 AUI47434 hypothetical protein -
BUN20_13185 3005038..3005343 - 306 AUI47435 hypothetical protein -
BUN20_13190 3005283..3005501 - 219 AUI47436 hypothetical protein -
BUN20_13195 3005533..3005790 - 258 AUI47437 hypothetical protein -
BUN20_13200 3005815..3007080 - 1266 AUI47438 PcfJ-like protein -
BUN20_13205 3007077..3007496 - 420 AUI47439 PcfK-like protein -
BUN20_13210 3007520..3007741 - 222 AUI47440 hypothetical protein -
BUN20_13215 3007753..3007968 - 216 AUI47441 hypothetical protein -
BUN20_13220 3007976..3008311 - 336 AUI47442 molybdenum ABC transporter ATP-binding protein -
BUN20_13225 3008289..3008600 + 312 Protein_2604 hypothetical protein -

Host bacterium

ID   309 Element type   ICE (Integrative and conjugative element)
Element name   ICEBfrQ1F2-1 GenBank   CP018937
Element size   5196111 bp Coordinate of oriT [Strand]   33719..33918 [-]
Host bacterium   Bacteroides fragilis strain Q1F2 Coordinate of element   2953654..3009208

Cargo genes

Drug resistance gene   tet(Q)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA9