Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 200307 |
Name | oriT_ICE_SpyHKU_rumA |
Organism | Streptococcus pyogenes HKU QMH11M0907901 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | AFRY01000001 (36476..36608 [+], 133 nt) |
oriT length | 133 nt |
IRs (inverted repeats) | 65..70, 83..88 (AAATCC..GGATTT) 6..12, 23..29 (ACCCCCC..GGGGGGT) |
Location of nic site | 75..76 |
Conserved sequence flanking the nic site |
TTTGGTTACA |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 133 nt
ACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATAC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 14347 | GenBank | EIK41756 |
Name | Relaxase_SPYOHK_04090_ICE_SpyHKU_rumA | UniProt ID | _ |
Length | 443 a.a. | PDB ID | |
Note | Predicted by oriTfinder 2.0 |
Relaxase protein sequence
Download Length: 443 a.a. Molecular weight: 52095.48 Da Isoelectric Point: 9.7884
MAITKIHPIKSTLNLAISYIVNGEKTDEQILVSTHKCHQETAHTQFLRTRNDAGTNGTVLARHLIQSFLP
GETSPEIAHQIGLELCKKILKDEYEFVLSTHIDKGHIHNHIIFNNVNMVTGKCYQSNKKSYHQIRYQSDK
LCKDNNLSVIDEFYESYKRKYKTNGKSWYENEQAKRGSSWKSKLQFDIDRLIKQSKDWEEFLKKMAELGY
EIKHGKHIAFKPKDKQKFTRAKTIGEDYTEERLRERITENQSIKAPPVKKRIGNVINMNTNAKVKESKGY
EYWATKHNLNTMAESVVFIREHGIKSVKQLDECIKKSAEERQNLQDKIKKIDKDMQLLSDTMEQVHTVKK
YRAYYKEYKANPSDKAFFEEHKSEITRYETDLAKLKKSYSKLPDSKDILDKLDKLQEKKNTLMQEYSSTK
STMDELYQIRKNYGIYMGKEMER
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
ID | 14348 | GenBank | EIK41766 |
Name | Rep_trans_SPYOHK_04140_ICE_SpyHKU_rumA | UniProt ID | _ |
Length | 453 a.a. | PDB ID | |
Note | Predicted by oriTfinder 2.0 |
Relaxase protein sequence
Download Length: 453 a.a. Molecular weight: 53284.17 Da Isoelectric Point: 8.5662
MAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAPLEMLFDYVRIRFPTTDVQH
VVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEF
FMDALVAGGVMKRLDLAINDKTGILNIPVLTEKCRQEECISVFRSFKSYRSGELVRKEEKECMGNTLYIG
SLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVYDNPEHTAFKIINRYIRF
VDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAPTLKVAIKLDEINQTQVV
KDILDHAKLTDRHKQILKQQSVKEQDVITTKKGYLSTIPVDRYPKKDIMGDKTVRVRADLHHIIKIETAK
NGGNVKEVMEIRLRSKLKSVLIVHYLKILYNRN
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Auxiliary protein
ID | 7873 | GenBank | EIK41785 |
Name | EIK41785_ICE_SpyHKU_rumA | UniProt ID | _ |
Length | 405 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 405 a.a. Molecular weight: 47021.92 Da Isoelectric Point: 9.7978
MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKD
IHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSE
NGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYS
KNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQ
AFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFC
TNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4CP
ID | 16839 | GenBank | EIK41739 |
Name | t4cp2_SPYOHK_04005_ICE_SpyHKU_rumA | UniProt ID | _ |
Length | 594 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 594 a.a. Molecular weight: 67889.37 Da Isoelectric Point: 9.0726
MIDKILKDIKGLFKVQDKSKFFKQNIPYLAFFYVGNIFSHHVRAYTGGDVIDKIFQGILELNTMSFIPSI
HPIDILMGVGVAVLIKFIVYTKGKNAKKFRQGKEYGSARWGTRKDIEPYVDEKFQNNILLTQTERLTMNG
RPANPKYARNKNVLVIGGSGSGKTRFYVKPNLMQMHSSYCVTDPKGTIVIECGKMLEDNGYEIKILNTIN
FKKSMKYNPFAYLRSEKDILKLVQTIIANTKGEGEKAGEDFWVKAEKLYYTALIGYIFYEAPREEKNFAT
LLDMIDASEVREDDETYMNPIDRLFEALEKKEPTHFAVKQYKKYKLAAGKTAKSILISCGARLAPFDIQE
LRDLMKEDELELDTLGDRKTALFVIISDTDDTFNFVVSIMYSQLFNLLCDKADDEYGGRLPVHVRCLLDE
FANIGLIPKFEKLIATIRSREISASIILQAQSQLKAIYKDNADTIVGNCDSTLFLGGKEKTTLKELSETL
GKETIDLYNTSETRSNANSYGLNYQKTGKELMSQDEITVMDGSKCIFQLRGVRPFLSDKFDITKHKNYKL
LEDFNKKNAFDIEEYIKRKGKAKLNRETVITRVQ
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
ID | 16840 | GenBank | EIK41765 |
Name | tcpA_SPYOHK_04135_ICE_SpyHKU_rumA | UniProt ID | _ |
Length | 461 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 461 a.a. Molecular weight: 53370.27 Da Isoelectric Point: 9.0687
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 815943..827945
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SPYOHK_03975 | 812433..813791 | + | 1359 | EIK41733 | 23S rRNA m(5)U1939 methyltransferase | - |
SPYOHK_03980 | 813791..813949 | + | 159 | EIK41734 | hypothetical protein | - |
SPYOHK_03985 | 813956..814237 | + | 282 | EIK41735 | membrane protein | - |
SPYOHK_03990 | 814328..815098 | + | 771 | EIK41736 | replication initiation protein | - |
SPYOHK_03995 | 815095..815946 | + | 852 | EIK41737 | hypothetical protein | - |
SPYOHK_04000 | 815943..816428 | + | 486 | EIK41738 | hypothetical protein | cd411 |
SPYOHK_04005 | 816425..818209 | + | 1785 | EIK41739 | putative conjugal transfer protein | virb4 |
SPYOHK_04010 | 818375..818686 | + | 312 | EIK41740 | single-stranded DNA binding protein | cd424 |
SPYOHK_04015 | 818690..818905 | + | 216 | EIK41741 | conjugative transposon membrane protein | prgF |
SPYOHK_04020 | 818925..819788 | + | 864 | EIK41742 | conjugative transposon membrane protein | prgHa |
SPYOHK_04025 | 819806..820069 | + | 264 | EIK41743 | conjugative transposon membrane exported protein | - |
SPYOHK_04030 | 820073..820462 | + | 390 | EIK41744 | conjugative transposon membrane protein | prgIa |
SPYOHK_04035 | 820374..821459 | + | 1086 | EIK41745 | conjugal transfer protein | virb4 |
SPYOHK_04040 | 822161..824035 | + | 1875 | EIK41746 | group II intron reverse transcriptase/maturase | - |
SPYOHK_04045 | 824054..825559 | + | 1506 | EIK41747 | conjugal transfer protein | virb4 |
SPYOHK_04050 | 825564..827696 | + | 2133 | EIK41748 | membrane protein | cd419b |
SPYOHK_04055 | 827709..827945 | + | 237 | EIK41749 | hypothetical protein | cd419 |
SPYOHK_04060 | 827923..830109 | + | 2187 | EIK41750 | cell surface protein | - |
SPYOHK_04065 | 830207..831913 | + | 1707 | EIK41751 | conjugative transposon DNA topoisomerase | - |
SPYOHK_04070 | 831997..832176 | + | 180 | EIK41752 | regulatory protein | - |
Region 2: 842509..874063
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SPYOHK_04085 | 842509..843168 | + | 660 | EIK41755 | conjugative transposon protein | cd424 |
SPYOHK_04090 | 843242..844573 | - | 1332 | EIK41756 | conjugative transposon mobilization protein | - |
SPYOHK_04095 | 844579..844929 | - | 351 | EIK41757 | hypothetical protein | - |
SPYOHK_04100 | 845269..845859 | + | 591 | EIK41758 | TetR family transcriptional regulator | - |
SPYOHK_04105 | 845871..846458 | + | 588 | EIK41759 | hypothetical protein | - |
SPYOHK_04110 | 846479..847180 | + | 702 | EIK41760 | hypothetical protein | - |
SPYOHK_04115 | 847173..847739 | + | 567 | EIK41761 | ABC cobalt transporter ATPase component | - |
SPYOHK_04120 | 847921..848040 | + | 120 | EIK41762 | hypothetical protein | - |
SPYOHK_04125 | 848063..848377 | + | 315 | EIK41763 | Tn916 ORF23 protein | orf23 |
SPYOHK_04130 | 848393..848779 | + | 387 | EIK41764 | Tn916 ORF22 protein | orf23 |
SPYOHK_04135 | 848808..850193 | + | 1386 | EIK41765 | Tn916 ORF21 FtsK/SpoIIIE family protein | virb4 |
SPYOHK_04140 | 850428..851789 | + | 1362 | EIK41766 | Cro/CI family transcriptional regulator | - |
SPYOHK_04145 | 851838..851921 | + | 84 | EIK41767 | leader peptide | - |
SPYOHK_04150 | 852046..852783 | + | 738 | EIK41768 | erythromycin resistance protein | - |
SPYOHK_04155 | 852788..852919 | + | 132 | EIK41769 | hypothetical protein | - |
SPYOHK_04160 | 853040..854287 | - | 1248 | EIK41770 | transposase | - |
SPYOHK_04165 | 854467..854688 | + | 222 | EIK41771 | Tn916 ORF19 protein | orf19 |
SPYOHK_04170 | 854805..855302 | + | 498 | EIK41772 | Tn916 ORF18 antirestriction (ArdA) protein | - |
SPYOHK_04175 | 855277..855783 | + | 507 | EIK41773 | Tn916 ORF17 signal peptide containing protein | orf17a |
SPYOHK_04180 | 855767..858214 | + | 2448 | EIK41774 | hypothetical protein | virb4 |
SPYOHK_04185 | 858217..860394 | + | 2178 | EIK41775 | Tn916 ORF15 signal peptide containing protein | orf15 |
SPYOHK_04190 | 860391..861392 | + | 1002 | EIK41776 | Tn916 ORF14 extracellular hydrolase/peptidase | orf14 |
SPYOHK_04195 | 861389..862321 | + | 933 | EIK41777 | Tn916 ORF13 protein | orf13 |
SPYOHK_04200 | 862566..862682 | + | 117 | EIK41778 | tetracycline resistance determinant leader peptide | - |
SPYOHK_04205 | 862698..864617 | + | 1920 | EIK41779 | Tn916 ORF11 tetracycline resistance protein | - |
SPYOHK_04210 | 864736..864903 | + | 168 | EIK41780 | hypothetical protein | - |
SPYOHK_04215 | 864963..865316 | - | 354 | EIK41781 | Tn916 ORF9 transcriptional regulator, putative | - |
SPYOHK_04220 | 865821..866243 | + | 423 | EIK41782 | Tn916 ORF7 DNA-binding protein | - |
SPYOHK_04225 | 866240..866470 | + | 231 | EIK41783 | hypothetical protein | - |
SPYOHK_04230 | 866931..867134 | + | 204 | EIK41784 | Tn916 ORF1 excisionase | - |
SPYOHK_04235 | 867216..868433 | + | 1218 | EIK41785 | Tn916 ORF2 integrase | - |
SPYOHK_04240 | 868621..869616 | - | 996 | EIK41786 | Integrase catalytic region | - |
SPYOHK_04245 | 869763..870557 | + | 795 | EIK41787 | ABC cobalt transporter ATPase component | virb4 |
SPYOHK_04250 | 870591..872336 | + | 1746 | EIK41788 | multidrug ABC transporter | - |
SPYOHK_04255 | 872330..874063 | + | 1734 | EIK41789 | multidrug ABC transporter | virb4 |
SPYOHK_04260 | 874099..875457 | + | 1359 | EIK41790 | Na+driven multidrug efflux pump | - |
SPYOHK_04265 | 875801..876211 | + | 411 | EIK41791 | hypothetical protein | - |
SPYOHK_04270 | 876668..876811 | + | 144 | EIK41792 | hypothetical protein | - |
SPYOHK_04275 | 876876..878675 | + | 1800 | EIK41793 | recombinase | - |
SPYOHK_04280 | 878709..878801 | + | 93 | EIK41794 | hypothetical protein | - |
Host bacterium
ID | 275 | Element type | ICE (Integrative and conjugative element) |
Element name | ICE_SpyHKU_rumA | GenBank | AFRY01000001 |
Element size | 1908100 bp | Coordinate of oriT [Strand] | 36476..36608 [+] |
Host bacterium | Streptococcus pyogenes HKU QMH11M0907901 | Coordinate of element | 813753..878646 |
Cargo genes
Drug resistance gene | erm(B), tet(M) |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA21 |