Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200300
Name   oriT_ICE_EfalV583_rplS in_silico
Organism   Enterococcus faecalis V583
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_004668 (97367..97409 [+], 43 nt)
oriT length   43 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 43 nt

>oriT_ICE_EfalV583_rplS
CAAGGTGTTAACTTTTTCAAATGAGTTAACACCTATGCAAATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14337 GenBank   WP_002360076
Name   mobT_EF_RS09055_ICE_EfalV583_rplS insolico UniProt ID   A0A828QMN8
Length   394 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 394 a.a.        Molecular weight: 46486.49 Da        Isoelectric Point: 9.1990

>WP_002360076.1 MULTISPECIES: MobT family relaxase [Lactobacillales]
MVQRNLDYRLLKDRRNEYGISQNKLATACGLSRPYLNQIENGGVTASTKTMRKIFNQLESFNPDLPLSLL
FDYVRIRFPTTDARKIIQEILHLKFDYMLHEDYAFYSYQEQYVMGDIVVMLSHEEDKGVLLELKGRGCRQ
FETFLLAQKRSWYDFFEDCLKAGGVMKRLDLAINDLVGLLDIPDLTKKCQKEECISLFRTFKSYRSGELL
KADEKDGMGNTLYIGSLKSEVYFCLYEKDYEQYIKLGIPLDKTETKNRFEIRLKNDRAYHAIQDLLKGRS
IESTTFSIINRYLRFADKVEGKRRTNWPLNEQWGRFIGRNRKEIQLTSEPKPYTIERTLNWLGRQVAPTW
KMAKELDRLNQTTYIQDMVQNARLSDRHKKILEQQSMAIENLII

  Protein domains


Predicted by InterproScan.

(11-58)

(165-369)

(69-157)


  Protein structure


Source ID Structure
AlphaFold DB A0A828QMN8


T4CP


ID   16830 GenBank   WP_002298803
Name   tcpA_EF_RS09075_ICE_EfalV583_rplS insolico UniProt ID   _
Length   338 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 338 a.a.        Molecular weight: 39619.99 Da        Isoelectric Point: 6.5901

>WP_002298803.1 MULTISPECIES: FtsK/SpoIIIE domain-containing protein [Lactobacillales]
MYKEHRIRARDQHLVYHFILGWLIALLISWMGVFYFQEFRQFDISRVSLSTIETVWSMKELICLLGSLGF
SGAMLLLYIHFFPDHWRSLWHRQKLARMILENHWYEVKQTQSEGFFKDLNSSRTRETISYFPKIYYRMKE
GLLSIRVQISLGKYQEQLLKLEKKLESGLYCELVEKELKDSYVEYTLLYDMIANRIGIDEVVAENGTLRL
MKNQVWAYDSLPHMLIAGGTGGGKTYFLLTIIEALLKSDAELFILDPKNADLADLGTVMPHVYSQKEEIS
ACVEDFYERMIARSKAMKEMPNYKPGENYAYLGLPPNFLIFDEYVAYMGANRFPTSIE

  Protein domains


Predicted by InterproScan.

(217-298)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1819850..2272107

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EF_RS17045 (EF1870) 1815784..1816680 - 897 Protein_1759 4Fe-4S binding protein -
EF_RS08980 (EF1871) 1816673..1817158 - 486 WP_002330914 TlpA disulfide reductase family protein -
EF_RS08985 (EF1872) 1817314..1817724 - 411 WP_002364129 hypothetical protein -
EF_RS16790 1818110..1818484 + 375 Protein_1762 plasmid mobilization relaxosome protein MobC -
EF_RS08995 (EF1874) 1818555..1819745 + 1191 WP_002330912 IS256-like element ISLgar5 family transposase -
EF_RS09000 (EF1875) 1819850..1820761 - 912 WP_010774217 conjugal transfer protein orf13
EF_RS09005 (EF1876) 1820780..1821784 - 1005 WP_002298830 bifunctional lysozyme/C40 family peptidase orf14
EF_RS09010 (EF1877) 1821781..1823904 - 2124 WP_002330911 transposase orf15
EF_RS09015 (EF1878) 1823909..1826356 - 2448 WP_002330910 ATP-binding protein virb4
EF_RS09020 (EF1879) 1826343..1826732 - 390 WP_002298826 conjugal transfer protein orf17a
EF_RS09025 (EF1880) 1826784..1827524 + 741 WP_002383098 hypothetical protein -
EF_RS09030 (EF1881) 1827531..1828367 - 837 WP_002360078 abortive infection family protein -
EF_RS09035 (EF1882) 1828432..1828935 - 504 WP_002369218 antirestriction protein ArdA -
EF_RS09040 (EF1883) 1828948..1829169 - 222 WP_002298822 hypothetical protein orf19
EF_RS09045 (EF1884) 1829566..1830816 + 1251 WP_002346915 IS110 family transposase -
EF_RS09050 (EF1885) 1830948..1831082 - 135 WP_002330905 DUF3789 domain-containing protein -
EF_RS09055 (EF1886) 1831079..1832263 - 1185 WP_002360076 MobT family relaxase -
EF_RS16570 (EF1887) 1832612..1832779 - 168 WP_002298811 hypothetical protein -
EF_RS09060 (EF1889) 1832772..1833447 - 676 Protein_1777 zeta toxin family protein -
EF_RS09065 (EF1890) 1833534..1833920 - 387 Protein_1778 ATP-binding protein -
EF_RS16795 1833992..1834483 - 492 WP_002384398 HNH endonuclease signature motif containing protein -
EF_RS16800 1834651..1835802 - 1152 WP_224561186 group II intron reverse transcriptase/maturase -
EF_RS09075 (EF1892) 1836459..1837475 - 1017 WP_002298803 FtsK/SpoIIIE domain-containing protein virb4
EF_RS09080 (EF1893) 1837545..1837889 - 345 WP_002369217 hypothetical protein -
EF_RS09085 (EF1894) 1837899..1838273 - 375 WP_002298800 YdcP family protein orf23
EF_RS09090 (EF1895) 1838286..1838600 - 315 WP_002298798 YdcP family protein orf23
EF_RS09095 (EF1896) 1838713..1841940 - 3228 WP_002369215 fibrinogen-binding MSCRAMM adhesin Fss3 -
EF_RS09100 (EF1897) 1842020..1842682 - 663 WP_002298795 hypothetical protein -
EF_RS09105 (EF1898) 1843053..1843400 - 348 WP_002357176 50S ribosomal protein L19 -
EF_RS09110 (EF1899) 1843544..1844284 - 741 WP_002381776 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
EF_RS09115 (EF1900) 1844274..1844798 - 525 WP_002369214 ribosome maturation factor RimM -
EF_RS09120 (EF1901) 1844906..1846267 - 1362 WP_002369213 Nramp family divalent metal transporter -
EF_RS09125 (EF1902) 1846464..1846838 + 375 WP_002383105 VOC family protein -
EF_RS09130 (EF1903) 1847069..1847668 + 600 WP_002357169 VTT domain-containing protein -
EF_RS09135 (EF1904) 1847769..1849571 + 1803 WP_002369211 glycerophosphodiester phosphodiesterase -
EF_RS09140 (EF1906) 1849760..1850446 - 687 WP_002357165 Bax inhibitor-1/YccA family protein -
EF_RS09145 (EF1907) 1850439..1850924 - 486 WP_002357164 MaoC/PaaZ C-terminal domain-containing protein -
EF_RS09150 (EF1908) 1851122..1852459 - 1338 WP_002357163 UDP-N-acetylmuramate--L-alanine ligase -
EF_RS09155 (EF1909) 1852614..1853567 - 954 WP_002360064 hypothetical protein -
EF_RS09160 (EF1910) 1853685..1854644 - 960 WP_002360063 aromatic acid exporter family protein -
EF_RS09165 (EF1911) 1854747..1855358 + 612 WP_002365791 aromatic acid exporter family protein -
EF_RS09170 (EF1912) 1855399..1856280 - 882 WP_002360061 ROK family protein -
EF_RS09175 (EF1913) 1856283..1856585 - 303 WP_002357157 membrane protein insertion efficiency factor YidD -
EF_RS16575 (EF1915) 1856763..1856915 + 153 WP_002357156 SPJ_0845 family protein -
EF_RS09180 (EF1916) 1856932..1857513 - 582 WP_002357155 ribosome biogenesis GTP-binding protein YihA/YsxC -
EF_RS09185 (EF1917) 1857611..1858864 - 1254 WP_002357154 ATP-dependent Clp protease ATP-binding subunit ClpX -
EF_RS09190 (EF1918) 1859056..1860084 + 1029 WP_002357153 lactonase family protein -
EF_RS09195 (EF1919) 1860163..1860651 - 489 WP_002379553 GNAT family N-acetyltransferase -
EF_RS09200 (EF1920) 1860663..1862036 - 1374 WP_002360057 C4-dicarboxylate transporter DcuC -
EF_RS09205 (EF1921) 1862053..1863006 - 954 WP_002383111 ribonucleoside hydrolase RihC -
EF_RS09210 (EF1922) 1863153..1865066 + 1914 WP_002383112 PfkB family carbohydrate kinase -
EF_RS09215 (EF1923) 1865185..1866692 + 1508 Protein_1810 helix-turn-helix domain-containing protein -
EF_RS09220 (EF1925) 1866995..1867840 - 846 WP_002379556 hypothetical protein -
EF_RS09225 (EF1926) 1867833..1868360 - 528 WP_002387303 5-bromo-4-chloroindolyl phosphate hydrolysis family protein -
EF_RS09230 (EF1927) 1868647..1869366 - 720 WP_002357140 MIP/aquaporin family protein -
EF_RS09235 (EF1928) 1869374..1871203 - 1830 WP_002379559 type 1 glycerol-3-phosphate oxidase -
EF_RS09240 (EF1929) 1871224..1872729 - 1506 WP_002357138 glycerol kinase GlpK -
EF_RS09245 (EF1931) 1873006..1874472 - 1467 WP_002383114 helix-turn-helix domain-containing protein -
EF_RS09250 (EF1932) 1874462..1875796 - 1335 WP_002379561 FAD-dependent oxidoreductase -
EF_RS09255 (EF1933) 1875976..1876332 + 357 WP_002357135 hypothetical protein -
EF_RS16580 (EF1934) 1876366..1876527 + 162 WP_002383115 hypothetical protein -
EF_RS09260 (EF1936) 1876769..1877209 - 441 WP_002387302 hypothetical protein -
EF_RS09265 (EF1937) 1877279..1877815 - 537 WP_010774219 GNAT family N-acetyltransferase -
EF_RS09270 (EF1938) 1877885..1880590 - 2706 WP_002377094 cation-translocating P-type ATPase -
EF_RS09275 (EF1939) 1880908..1881558 - 651 WP_002383117 membrane protein -
EF_RS09280 (EF1940) 1881647..1882312 + 666 WP_002379563 transcriptional regulator YeiL -
EF_RS09285 (EF1941) 1882384..1882779 + 396 WP_002379564 DUF3224 domain-containing protein -
EF_RS09290 (EF1943) 1882889..1884070 + 1182 WP_002365813 multidrug effflux MFS transporter -
EF_RS09295 (EF1945) 1884251..1886086 - 1836 WP_002379566 alkaline phosphatase family protein -
EF_RS16585 (EF1947) 1886295..1886444 + 150 WP_002357118 hypothetical protein -
EF_RS09300 (EF1948) 1886595..1886945 + 351 WP_002357112 DUF1801 domain-containing protein -
EF_RS09305 (EF1949) 1886956..1887306 - 351 WP_002360043 DUF2200 domain-containing protein -
EF_RS09310 (EF1950) 1887380..1888384 - 1005 WP_010774220 SIS domain-containing protein -
EF_RS09315 (EF1951) 1888378..1889454 - 1077 WP_002383119 SIS domain-containing protein -
EF_RS09320 (EF1952) 1889465..1890298 - 834 WP_002383120 PTS system mannose/fructose/sorbose family transporter subunit IID -
EF_RS09325 (EF1953) 1890279..1891070 - 792 WP_002357107 PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC -
EF_RS09330 1891086..1891556 - 471 WP_002357106 PTS sugar transporter subunit IIB -
EF_RS09335 1891568..1891987 - 420 WP_002389037 PTS fructose transporter subunit IIA -
EF_RS09340 (EF1955) 1892059..1894830 - 2772 WP_002383122 sigma-54-dependent transcriptional regulator -
EF_RS16805 (EF1956) 1894974..1895189 - 216 WP_002357102 hypothetical protein -
EF_RS09345 (EF1958) 1895401..1896762 - 1362 WP_002357101 deoxyguanosinetriphosphate triphosphohydrolase -
EF_RS09350 (EF1959) 1896779..1897603 - 825 WP_002357099 toll/interleukin-1 receptor domain-containing protein -
EF_RS09355 (EF1961) 1897956..1899254 - 1299 WP_002357098 phosphopyruvate hydratase -
EF_RS09360 (EF1962) 1899386..1900141 - 756 WP_002357096 triose-phosphate isomerase -
EF_RS09365 (EF1963) 1900190..1901383 - 1194 WP_002357094 phosphoglycerate kinase -
EF_RS09370 (EF1964) 1901510..1902511 - 1002 WP_002357093 type I glyceraldehyde-3-phosphate dehydrogenase -
EF_RS09375 (EF1965) 1902551..1903588 - 1038 WP_002357092 sugar-binding domain-containing protein -
EF_RS09380 (EF1966) 1904008..1904886 - 879 WP_002357090 YitT family protein -
EF_RS09385 (EF1967) 1905029..1905598 - 570 WP_002364165 TIGR01440 family protein -
EF_RS09390 (EF1968) 1905595..1906101 - 507 WP_002357086 ECF transporter S component -
EF_RS09395 (EF1969) 1906085..1906921 - 837 WP_002383128 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
EF_RS09400 (EF1970) 1907075..1908844 - 1770 WP_002379571 aspartate--tRNA ligase -
EF_RS09405 (EF1971) 1908862..1910163 - 1302 WP_002366882 histidine--tRNA ligase -
EF_RS16810 (EF1972) 1910160..1910381 - 222 WP_002383130 hypothetical protein -
EF_RS09415 (EF1973) 1910521..1910967 - 447 WP_002357080 D-aminoacyl-tRNA deacylase -
EF_RS09420 (EF1974) 1910991..1913204 - 2214 WP_002357079 bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase -
EF_RS09425 (EF1975) 1913419..1914171 - 753 WP_002370972 16S rRNA (uracil(1498)-N(3))-methyltransferase -
EF_RS09430 (EF1976) 1914173..1915120 - 948 WP_011109511 50S ribosomal protein L11 methyltransferase -
EF_RS09435 (EF1977) 1915136..1915621 - 486 WP_002388170 DUF3013 family protein -
EF_RS09440 (EF1978) 1915578..1916255 - 678 WP_002364174 DNA-3-methyladenine glycosylase -
EF_RS09445 (EF1979) 1916384..1917661 + 1278 WP_011109512 replication-associated recombination protein A -
EF_RS09455 (EF1980) 1917935..1918267 + 333 WP_002357068 hypothetical protein -
EF_RS09460 (EF1982) 1918585..1919058 + 474 WP_002357065 universal stress protein -
EF_RS09465 (EF1983) 1919170..1920357 - 1188 WP_002357064 acetate kinase -
EF_RS09475 (EF1984) 1920382..1921389 - 1008 Protein_1863 class I SAM-dependent methyltransferase -
EF_RS09480 (EF1985) 1921518..1921871 - 354 WP_002357061 competence type IV pilus minor pilin ComGG -
EF_RS09485 (EF1986) 1921871..1922305 - 435 WP_002357060 competence type IV pilus minor pilin ComGF -
EF_RS09490 (EF1987) 1922295..1922696 - 402 WP_002383134 type II secretion system protein -
EF_RS16950 (EF1988) 1923000..1923125 + 126 WP_002364184 hypothetical protein -
EF_RS09495 (EF1989) 1923422..1924363 - 942 WP_002364185 ferrochelatase -
EF_RS09505 (EF1990) 1925103..1925351 - 249 WP_002383136 hypothetical protein -
EF_RS09510 (EF1991) 1925423..1925623 - 201 WP_002357053 cold-shock protein -
EF_RS09515 (EF1992) 1926460..1927701 - 1242 WP_002370962 LysM peptidoglycan-binding domain-containing protein -
EF_RS09520 (EF1993) 1927702..1927935 - 234 WP_002384371 phage holin -
EF_RS09525 1927928..1928149 - 222 WP_002364191 hypothetical protein -
EF_RS09530 (EF1994) 1928184..1928339 - 156 WP_002364192 XkdX family protein -
EF_RS09535 (EF1995) 1928341..1928661 - 321 WP_002389262 hypothetical protein -
EF_RS09540 (EF1996) 1928675..1929166 - 492 WP_002364194 hypothetical protein -
EF_RS09545 1929166..1929453 - 288 WP_002357046 collagen-like protein -
EF_RS09550 (EF1998) 1929450..1930046 - 597 WP_002357045 hypothetical protein -
EF_RS09555 (EF2000) 1930039..1930921 - 883 Protein_1879 phage baseplate upper protein -
EF_RS09560 (EF2001) 1930940..1933747 - 2808 WP_002387289 phage tail spike protein -
EF_RS09565 (EF2002) 1933729..1934463 - 735 WP_011109514 tail protein -
EF_RS09570 (EF2003) 1934453..1937350 - 2898 WP_002387288 tape measure protein -
EF_RS09575 (EF2004) 1937598..1937948 - 351 WP_002357039 hypothetical protein -
EF_RS09580 (EF2005) 1938001..1938849 - 849 WP_002387287 major tail protein -
EF_RS09585 (EF2006) 1938850..1939224 - 375 WP_002387286 DUF6838 family protein -
EF_RS09590 (EF2007) 1939227..1939625 - 399 WP_002357036 HK97 gp10 family phage protein -
EF_RS09595 (EF2008) 1939618..1939992 - 375 WP_002387285 hypothetical protein -
EF_RS09600 (EF2009) 1939989..1940333 - 345 WP_002387282 hypothetical protein -
EF_RS09605 (EF2010) 1940347..1940529 - 183 WP_002387281 hypothetical protein -
EF_RS09610 (EF2011) 1940558..1941445 - 888 WP_002387280 DUF5309 domain-containing protein -
EF_RS09615 (EF2012) 1941459..1942082 - 624 WP_010706493 DUF4355 domain-containing protein -
EF_RS09620 (EF2013) 1942301..1942621 - 321 WP_002380436 hypothetical protein -
EF_RS09625 (EF2014) 1942678..1942908 - 231 WP_002380437 hypothetical protein -
EF_RS09630 (EF2015) 1942909..1944813 - 1905 WP_010706494 head protein -
EF_RS09635 (EF2016) 1944788..1946260 - 1473 WP_010706495 phage portal protein -
EF_RS09640 (EF2017) 1946272..1947660 - 1389 WP_002387276 phage terminase large subunit -
EF_RS09645 (EF2018) 1947653..1948114 - 462 WP_002383816 helix-turn-helix domain-containing protein -
EF_RS09650 (EF2019) 1948190..1948366 - 177 WP_010706496 hypothetical protein -
EF_RS09655 (EF2020) 1948550..1949362 - 813 WP_002383813 hypothetical protein -
EF_RS16590 (EF2021) 1949474..1949707 - 234 Protein_1900 hypothetical protein -
EF_RS09660 1950515..1950760 - 246 WP_010716537 hypothetical protein -
EF_RS09665 (EF2022) 1950785..1951708 - 924 WP_002383810 DUF6731 family protein -
EF_RS09675 (EF2024) 1952426..1952842 - 417 WP_010706497 ArpU family phage packaging/lysis transcriptional regulator -
EF_RS09680 (EF2026) 1953750..1954158 - 409 Protein_1904 RusA family crossover junction endodeoxyribonuclease -
EF_RS09685 (EF2027) 1954155..1955012 - 858 WP_002387271 helix-turn-helix domain-containing protein -
EF_RS09690 (EF2028) 1955012..1955212 - 201 WP_002357010 hypothetical protein -
EF_RS16815 1955217..1955600 - 384 WP_002383802 putative HNHc nuclease -
EF_RS16820 1955639..1955857 - 219 WP_010774222 hypothetical protein -
EF_RS09700 (EF2031) 1955862..1956596 - 735 WP_002383799 ERF family protein -
EF_RS09705 (EF2032) 1956589..1956906 - 318 WP_002383798 hypothetical protein -
EF_RS09710 (EF2034) 1957102..1957440 - 339 WP_002383796 hypothetical protein -
EF_RS09715 1957477..1957686 - 210 WP_002378465 hypothetical protein -
EF_RS09720 (EF2036) 1957741..1957929 + 189 WP_002357001 YegP family protein -
EF_RS09725 (EF2037) 1957955..1958677 - 723 WP_002387270 phage regulatory protein -
EF_RS09730 (EF2038) 1958700..1959011 - 312 WP_002403885 hypothetical protein -
EF_RS09735 (EF2039) 1959023..1959214 - 192 WP_002383936 hypothetical protein -
EF_RS09740 (EF2040) 1959510..1959851 + 342 WP_002387267 helix-turn-helix transcriptional regulator -
EF_RS09745 (EF2041) 1959856..1960506 + 651 WP_002387266 ImmA/IrrE family metallo-endopeptidase -
EF_RS09750 (EF2042) 1960602..1961231 + 630 WP_002387265 SHOCT domain-containing protein -
EF_RS09755 (EF2043) 1961337..1962485 + 1149 WP_002387264 site-specific integrase -
EF_RS09760 1962522..1962956 - 435 Protein_1921 competence type IV pilus minor pilin ComGD -
EF_RS09765 (EF2044) 1962953..1963228 - 276 WP_002356991 competence type IV pilus major pilin ComGC -
EF_RS09770 (EF2045) 1963228..1964274 - 1047 WP_002356990 competence type IV pilus assembly protein ComGB -
EF_RS09775 (EF2046) 1964231..1965199 - 969 WP_002364362 competence type IV pilus ATPase ComGA -
EF_RS09780 (EF2047) 1965440..1966768 - 1329 WP_002362058 amino acid permease -
EF_RS09785 (EF2048) 1967059..1968132 - 1074 WP_002356987 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
EF_RS09790 (EF2049) 1968257..1970086 - 1830 WP_002383725 ABC transporter permease -
EF_RS09795 (EF2050) 1970076..1970825 - 750 WP_002381711 ABC transporter ATP-binding protein -
EF_RS09800 (EF2051) 1970943..1971644 - 702 WP_002364244 GntR family transcriptional regulator -
EF_RS09805 (EF2052) 1971775..1974198 - 2424 WP_002364367 DNA translocase FtsK -
EF_RS09810 (EF2055) 1974512..1975723 - 1212 WP_002360017 NAD(P)/FAD-dependent oxidoreductase -
EF_RS09815 (EF2056) 1975752..1976657 - 906 WP_002360016 prenyltransferase -
EF_RS09820 (EF2057) 1976779..1977759 + 981 WP_002360015 polyprenyl synthetase family protein -
EF_RS09825 (EF2058) 1977839..1979605 - 1767 WP_002383727 thiol reductant ABC exporter subunit CydC -
EF_RS09830 (EF2059) 1979602..1981335 - 1734 WP_002378477 thiol reductant ABC exporter subunit CydD -
EF_RS09835 (EF2060) 1981340..1982353 - 1014 WP_002379582 cytochrome d ubiquinol oxidase subunit II -
EF_RS09840 (EF2061) 1982350..1983768 - 1419 WP_002356974 cytochrome ubiquinol oxidase subunit I -
EF_RS09845 (EF2063) 1984500..1985363 - 864 WP_002379583 AraC family transcriptional regulator -
EF_RS09850 (EF2064) 1985448..1987529 - 2082 WP_002362072 DNA topoisomerase III -
EF_RS09855 (EF2065) 1987660..1988025 - 366 WP_002356966 DUF1033 family protein -
EF_RS09860 (EF2066) 1988123..1988692 - 570 WP_002379584 TetR/AcrR family transcriptional regulator -
EF_RS09865 (EF2067) 1988825..1989340 + 516 WP_002379586 YbhB/YbcL family Raf kinase inhibitor-like protein -
EF_RS09870 (EF2068) 1989357..1990595 + 1239 WP_002362074 multidrug efflux MFS transporter -
EF_RS09875 (EF2070) 1990775..1991899 - 1125 WP_002362075 tRNA 2-thiouridine(34) synthase MnmA -
EF_RS09880 (EF2071) 1992125..1992469 - 345 WP_002356959 DUF1831 domain-containing protein -
EF_RS09885 (EF2072) 1992537..1993682 - 1146 WP_002360007 cysteine desulfurase family protein -
EF_RS09890 (EF2073) 1993839..1994813 - 975 WP_002379587 ribose-phosphate diphosphokinase -
EF_RS09895 (EF2074) 1995027..1995776 + 750 WP_002360005 metal ABC transporter ATP-binding protein -
EF_RS09900 (EF2075) 1995773..1996642 + 870 WP_002364373 metal ABC transporter permease -
EF_RS09905 (EF2076) 1996629..1997555 + 927 WP_002356954 metal ABC transporter substrate-binding protein -
EF_RS09910 (EF2077) 1997610..1999148 - 1539 WP_002362078 ABC-F family ATP-binding cassette domain-containing protein -
EF_RS09915 (EF2079) 1999518..2000711 - 1194 WP_002383734 amidohydrolase -
EF_RS09920 (EF2080) 2000726..2001559 - 834 WP_002383735 MetQ/NlpA family ABC transporter substrate-binding protein -
EF_RS09925 (EF2081) 2001579..2002259 - 681 WP_002359998 methionine ABC transporter permease -
EF_RS09930 (EF2082) 2002278..2003348 - 1071 WP_002356948 methionine ABC transporter ATP-binding protein -
EF_RS09940 (EF2084) 2004910..2005158 + 249 WP_002359996 hypothetical protein -
EF_RS09945 (EF2085) 2005177..2006145 - 969 WP_002359995 Abi family protein -
EF_RS09955 (EF2086) 2006956..2007957 - 1002 WP_002399567 GH25 family lysozyme -
EF_RS09960 (EF2087) 2007929..2008207 - 279 WP_002359993 phage holin family protein -
EF_RS09965 (EF2088) 2008207..2008461 - 255 WP_002359992 hypothetical protein -
EF_RS09970 (EF2089) 2008474..2008893 - 420 WP_002359991 XkdX family protein -
EF_RS09975 (EF2090) 2008881..2009741 - 861 WP_002399568 collagen-like protein -
EF_RS09980 (EF2091) 2009728..2010216 - 489 WP_002359989 hypothetical protein -
EF_RS09985 (EF2092) 2010229..2010921 - 693 WP_002359987 hypothetical protein -
EF_RS09990 (EF2093) 2010918..2013494 - 2577 WP_002359986 phage tail tip lysozyme -
EF_RS09995 (EF2094) 2013531..2014433 - 903 WP_010706507 hypothetical protein -
EF_RS10000 (EF2095) 2014448..2015563 - 1116 WP_002399570 hypothetical protein -
EF_RS10005 (EF2096) 2015568..2020730 - 5163 WP_002399571 tape measure protein -
EF_RS10010 (EF2097) 2020731..2021036 - 306 WP_002359982 hypothetical protein -
EF_RS10015 (EF2098) 2021039..2021623 - 585 WP_002359981 hypothetical protein -
EF_RS10020 (EF2099) 2021650..2022984 - 1335 WP_002399573 hypothetical protein -
EF_RS10025 (EF2100) 2023000..2023440 - 441 WP_002359979 immunoglobulin-like domain-containing protein -
EF_RS10030 (EF2101) 2023453..2023842 - 390 WP_002359978 hypothetical protein -
EF_RS10035 (EF2102) 2023843..2024058 - 216 WP_002359976 hypothetical protein -
EF_RS10040 (EF2103) 2024055..2024762 - 708 WP_002359974 hypothetical protein -
EF_RS10045 (EF2104) 2024782..2025960 - 1179 WP_002359973 hypothetical protein -
EF_RS10050 (EF2105) 2025964..2026995 - 1032 WP_002399574 hypothetical protein -
EF_RS10055 (EF2106) 2026997..2027305 - 309 WP_002359971 hypothetical protein -
EF_RS10060 (EF2107) 2027302..2027481 - 180 WP_002359970 hypothetical protein -
EF_RS10065 (EF2108) 2027499..2027828 - 330 WP_002359968 hypothetical protein -
EF_RS10070 (EF2109) 2027848..2028429 - 582 WP_002359967 hypothetical protein -
EF_RS10075 (EF2110) 2028413..2028943 - 531 WP_002359966 hypothetical protein -
EF_RS10080 (EF2111) 2028940..2030220 - 1281 WP_002359965 hypothetical protein -
EF_RS10085 (EF2112) 2030238..2031797 - 1560 WP_002380477 terminase family protein -
EF_RS10090 (EF2113) 2031763..2032182 - 420 WP_002393641 KGG domain-containing protein -
EF_RS10095 (EF2114) 2032172..2033374 - 1203 WP_002399577 DNA modification methylase -
EF_RS10105 (EF2115) 2033782..2034207 - 426 WP_002359961 ArpU family phage packaging/lysis transcriptional regulator -
EF_RS10110 (EF2117) 2034506..2034706 - 201 WP_002359960 hypothetical protein -
EF_RS10115 (EF2118) 2034720..2035274 - 555 WP_002399578 DUF3850 domain-containing protein -
EF_RS10120 (EF2119) 2035274..2035591 - 318 WP_010714055 hypothetical protein -
EF_RS16825 (EF2120) 2035759..2036301 - 543 WP_002399580 hypothetical protein -
EF_RS10135 (EF2121) 2036326..2036550 - 225 WP_002399581 hypothetical protein -
EF_RS10140 (EF2123) 2036640..2036852 - 213 WP_002399583 hypothetical protein -
EF_RS10145 (EF2124) 2036930..2037412 - 483 WP_011109521 class I SAM-dependent methyltransferase -
EF_RS16600 2037559..2037702 - 144 WP_021733001 hypothetical protein -
EF_RS10150 (EF2126) 2037719..2038069 - 351 WP_010714057 hypothetical protein -
EF_RS10155 (EF2127) 2038081..2038413 - 333 WP_002399587 hypothetical protein -
EF_RS10160 (EF2128) 2038410..2038835 - 426 WP_010774223 RusA family crossover junction endodeoxyribonuclease -
EF_RS10165 (EF2129) 2038844..2039713 - 870 WP_002399589 ATP-binding protein -
EF_RS10170 (EF2130) 2039727..2040578 - 852 WP_010714058 Lin1244/Lin1753 domain-containing protein -
EF_RS10175 (EF2131) 2040592..2041410 - 819 WP_002399591 PD-(D/E)XK nuclease-like domain-containing protein -
EF_RS10180 (EF2132) 2041370..2042293 - 924 WP_002399592 RecT family recombinase -
EF_RS10185 (EF2133) 2042283..2042615 - 333 WP_010706514 hypothetical protein -
EF_RS10190 (EF2134) 2042638..2042928 - 291 WP_002399594 hypothetical protein -
EF_RS10195 (EF2135) 2043013..2043339 - 327 WP_002399595 hypothetical protein -
EF_RS10200 (EF2136) 2043340..2043549 - 210 WP_002359948 hypothetical protein -
EF_RS10205 (EF2138) 2043692..2043943 - 252 WP_002359946 helix-turn-helix transcriptional regulator -
EF_RS10210 (EF2139) 2043958..2044485 - 528 WP_002399596 hypothetical protein -
EF_RS10215 (EF2140) 2044543..2044716 - 174 WP_002415790 hypothetical protein -
EF_RS10220 (EF2141) 2044730..2044951 - 222 WP_002399598 helix-turn-helix transcriptional regulator -
EF_RS10225 (EF2142) 2045101..2045460 + 360 WP_002399599 helix-turn-helix transcriptional regulator -
EF_RS10230 (EF2143) 2045470..2045937 + 468 WP_002399600 ImmA/IrrE family metallo-endopeptidase -
EF_RS10235 (EF2144) 2045958..2046818 + 861 WP_010712986 lipoprotein -
EF_RS10240 (EF2145) 2047004..2048146 + 1143 WP_010774224 site-specific integrase -
EF_RS10245 (EF2146) 2048429..2049919 + 1491 WP_002383738 glucosyltransferase domain-containing protein -
EF_RS10250 (EF2147) 2050132..2050311 + 180 WP_002383739 hypothetical protein -
EF_RS10255 (EF2148) 2050399..2051364 - 966 WP_002379592 hypothetical protein -
EF_RS10260 (EF2149) 2051540..2051830 - 291 WP_002379593 hypothetical protein -
EF_RS10265 (EF2150) 2051878..2053116 - 1239 WP_002379594 aminoacyltransferase -
EF_RS10270 (EF2151) 2053427..2055235 - 1809 WP_002383741 glutamine--fructose-6-phosphate transaminase (isomerizing) -
EF_RS10275 (EF2152) 2055678..2056511 - 834 WP_002356939 energy-coupling factor transporter transmembrane component T -
EF_RS10280 (EF2153) 2056508..2058214 - 1707 WP_002380507 ABC transporter ATP-binding protein -
EF_RS10285 (EF2154) 2058315..2058866 - 552 WP_002356937 ECF-type riboflavin transporter substrate-binding protein -
EF_RS10290 (EF2155) 2059096..2060449 - 1354 Protein_2024 phosphoglucosamine mutase -
EF_RS10295 (EF2156) 2060442..2061605 - 1164 WP_002379597 CdaR family protein -
EF_RS10300 (EF2157) 2061602..2062486 - 885 WP_002389035 diadenylate cyclase CdaA -
EF_RS10305 (EF2158) 2062683..2066414 - 3732 WP_002383743 pyruvate:ferredoxin (flavodoxin) oxidoreductase -
EF_RS10310 (EF2159) 2066672..2068012 - 1341 WP_002356929 type I glutamate--ammonia ligase -
EF_RS10315 (EF2160) 2068055..2068438 - 384 WP_002388239 MerR family transcriptional regulator -
EF_RS10320 (EF2161) 2068641..2069882 - 1242 WP_002379600 GTPase HflX -
EF_RS10325 (EF2162) 2069886..2070815 - 930 WP_002366931 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
EF_RS10330 (EF2163) 2070816..2071562 - 747 WP_002379601 glycerophosphodiester phosphodiesterase -
EF_RS10335 (EF2164) 2071671..2073482 - 1812 WP_010774225 DUF6056 family protein -
EF_RS10340 (EF2165) 2073479..2074453 - 975 WP_002383748 GDP-mannose 4,6-dehydratase -
EF_RS10345 (EF2166) 2074545..2075966 - 1422 WP_002380514 hypothetical protein -
EF_RS10350 (EF2167) 2075977..2076948 - 972 WP_002383749 glycosyltransferase family 2 protein -
EF_RS10355 (EF2168) 2076988..2077812 - 825 WP_002379605 LicD family protein -
EF_RS10360 (EF2169) 2077867..2079297 - 1431 WP_002379606 O-antigen ligase family protein -
EF_RS10365 (EF2170) 2079338..2080312 - 975 WP_002383750 glycosyltransferase -
EF_RS10370 (EF2171) 2080314..2081372 - 1059 WP_002383751 NAD-dependent epimerase/dehydratase family protein -
EF_RS10375 (EF2172) 2081385..2082089 - 705 WP_002380521 IspD/TarI family cytidylyltransferase -
EF_RS10380 (EF2173) 2082363..2083541 + 1179 WP_000997695 IS256-like element ISEf1 family transposase -
EF_RS10385 (EF2174) 2083902..2086583 - 2682 WP_002383753 DUF5776 domain-containing protein -
EF_RS10390 (EF2175) 2086827..2087675 - 849 WP_002379609 LicD family protein -
EF_RS10395 (EF2176) 2087691..2088449 - 759 WP_002379610 glycosyltransferase family 2 protein -
EF_RS10400 (EF2177) 2088584..2089981 - 1398 WP_002356909 sugar transferase -
EF_RS10405 (EF2178) 2090087..2091388 - 1302 WP_002383757 EpaQ family protein -
EF_RS10410 (EF2179) 2091417..2093420 - 2004 WP_002383759 hypothetical protein -
EF_RS10415 (EF2180) 2093421..2095562 - 2142 WP_002378512 glycosyltransferase family 2 protein -
EF_RS10420 (EF2181) 2095574..2098717 - 3144 WP_002383762 glycosyltransferase -
EF_RS10425 (EF2182) 2098707..2099924 - 1218 WP_002356901 ABC transporter ATP-binding protein -
EF_RS10430 (EF2183) 2099937..2100731 - 795 WP_002356900 ABC transporter permease -
EF_RS10435 (EF2184) 2100979..2101320 + 342 WP_002356899 EamA family transporter -
EF_RS10440 (EF2185) 2101597..2102775 + 1179 WP_000997695 IS256-like element ISEf1 family transposase -
EF_RS10445 (EF2186) 2102800..2103051 - 252 WP_011109525 hypothetical protein -
EF_RS10450 (EF2187) 2103109..2104281 - 1173 WP_000195429 IS256-like element IS256 family transposase -
EF_RS10455 (EF2188) 2104378..2105082 - 705 WP_011109526 acyltransferase family protein -
EF_RS10460 (EF2189) 2105075..2105440 - 366 WP_002379614 DUF2304 domain-containing protein -
EF_RS10465 (EF2190) 2105440..2106165 - 726 WP_002379615 glycosyltransferase family 2 protein -
EF_RS10470 (EF2191) 2106224..2107066 - 843 WP_002379616 dTDP-4-dehydrorhamnose reductase -
EF_RS10475 (EF2192) 2107159..2108187 - 1029 WP_002359895 dTDP-glucose 4,6-dehydratase -
EF_RS10480 (EF2193) 2108212..2108784 - 573 WP_002356893 dTDP-4-dehydrorhamnose 3,5-epimerase -
EF_RS10485 (EF2194) 2108797..2109663 - 867 WP_002364387 glucose-1-phosphate thymidylyltransferase RfbA -
EF_RS10490 (EF2195) 2109785..2110498 - 714 WP_002362119 glycosyltransferase family 2 protein -
EF_RS10495 (EF2196) 2110502..2111329 - 828 WP_002383764 glycosyltransferase -
EF_RS10500 (EF2197) 2111329..2112117 - 789 WP_002383765 glycosyltransferase family 2 protein -
EF_RS10505 (EF2198) 2112239..2113375 - 1137 WP_002366956 MraY family glycosyltransferase -
EF_RS10510 (EF2199) 2113486..2114394 - 909 WP_002383768 YihY/virulence factor BrkB family protein -
EF_RS10515 (EF2200) 2114410..2115174 - 765 WP_002356886 type I methionyl aminopeptidase -
EF_RS10520 (EF2201) 2115349..2115792 + 444 WP_002356885 flavodoxin -
EF_RS10525 (EF2202) 2115867..2116340 - 474 WP_002383769 TspO/MBR family protein -
EF_RS10530 (EF2203) 2116498..2117070 - 573 WP_002356883 TetR/AcrR family transcriptional regulator -
EF_RS10535 (EF2204) 2117321..2118558 + 1238 Protein_2073 aminopeptidase -
EF_RS10540 (EF2205) 2118818..2119198 + 381 WP_002383771 PH domain-containing protein -
EF_RS10550 (EF2206) 2119416..2119937 - 522 WP_002362126 tRNA adenosine(34) deaminase TadA -
EF_RS10555 (EF2207) 2120015..2120866 + 852 WP_002383772 helix-turn-helix domain-containing protein -
EF_RS10560 (EF2208) 2120923..2121768 + 846 WP_002372093 PhzF family phenazine biosynthesis protein -
EF_RS10565 (EF2209) 2121795..2122133 - 339 WP_002356871 hypothetical protein -
EF_RS10570 (EF2210) 2122217..2122921 - 705 WP_002383773 zinc metallopeptidase -
EF_RS10575 (EF2211) 2123120..2123473 + 354 WP_002387247 YxeA family protein -
EF_RS10580 (EF2212) 2123511..2124515 - 1005 WP_002387246 nucleoid-associated protein -
EF_RS10585 (EF2213) 2124643..2126109 - 1467 WP_002383776 PTS system trehalose-specific EIIBC component -
EF_RS10590 (EF2214) 2126321..2126701 + 381 WP_002383777 VOC family protein -
EF_RS10595 (EF2215) 2126723..2127205 + 483 WP_002356863 SRPBCC family protein -
EF_RS10600 (EF2216) 2127249..2128361 - 1113 WP_002383778 FUSC family protein -
EF_RS10605 (EF2217) 2128534..2130675 + 2142 WP_002374433 GH92 family glycosyl hydrolase -
EF_RS10610 (EF2218) 2130716..2132197 - 1482 WP_002387242 response regulator transcription factor -
EF_RS10615 (EF2219) 2132209..2133939 - 1731 WP_002387241 sensor histidine kinase -
EF_RS10620 (EF2220) 2133893..2134528 - 636 WP_002362905 DUF624 domain-containing protein -
EF_RS10625 (EF2221) 2134599..2136065 - 1467 WP_002370392 ABC transporter substrate-binding protein -
EF_RS10630 (EF2222) 2136089..2137012 - 924 WP_002359877 carbohydrate ABC transporter permease -
EF_RS10635 (EF2223) 2137024..2137980 - 957 WP_002356852 ABC transporter permease subunit -
EF_RS10640 (EF2224) 2138519..2143018 - 4500 WP_011109527 isopeptide-forming domain-containing fimbrial protein -
EF_RS10645 (EF2225) 2143492..2144307 - 816 WP_002383586 MerR family transcriptional regulator -
EF_RS10650 (EF2226) 2144374..2146101 + 1728 WP_002359874 ABC transporter ATP-binding protein -
EF_RS10655 (EF2227) 2146154..2147932 + 1779 WP_002374418 ABC transporter ATP-binding protein -
EF_RS10660 (EF2228) 2147986..2148990 - 1005 WP_002379621 tryptophan--tRNA ligase -
EF_RS10665 (EF2229) 2149152..2152931 - 3780 WP_002383585 Ig-like domain-containing protein -
EF_RS10670 (EF2230) 2152942..2153910 - 969 WP_002383584 hypothetical protein -
EF_RS10675 (EF2231) 2154011..2154682 - 672 WP_002383583 hypothetical protein -
EF_RS10680 (EF2232) 2154695..2155612 - 918 WP_002383582 carbohydrate ABC transporter permease -
EF_RS10685 (EF2233) 2155585..2156487 - 903 WP_002356840 sugar ABC transporter permease -
EF_RS10690 (EF2234) 2156638..2157915 - 1278 WP_002359868 sugar ABC transporter substrate-binding protein -
EF_RS10695 (EF2235) 2157965..2159107 - 1143 WP_002359867 glycoside hydrolase family 88 protein -
EF_RS10700 (EF2236) 2159123..2160922 - 1800 WP_002359866 DUF2264 domain-containing protein -
EF_RS10705 (EF2237) 2160903..2161289 - 387 WP_002359865 membrane lipoprotein lipid attachment site-containing protein -
EF_RS10710 (EF2238) 2161465..2162526 + 1062 WP_002356832 LacI family DNA-binding transcriptional regulator -
EF_RS10715 (EF2239) 2162567..2163400 - 834 WP_002369000 hypothetical protein -
EF_RS10720 (EF2240) 2163823..2164971 - 1149 WP_002383579 site-specific integrase -
EF_RS10725 (EF2241) 2164977..2165162 - 186 WP_002359862 DUF3173 domain-containing protein -
EF_RS10730 (EF2243) 2166261..2166452 - 192 WP_002399806 helix-turn-helix domain-containing protein -
EF_RS10735 (EF2244) 2166531..2166989 - 459 WP_002359860 sigma-70 family RNA polymerase sigma factor -
EF_RS10740 (EF2245) 2166991..2167452 - 462 WP_002359859 hypothetical protein -
EF_RS10745 (EF2247) 2168130..2168864 - 735 WP_002359858 winged helix-turn-helix domain-containing protein -
EF_RS10750 (EF2248) 2169108..2172122 - 3015 WP_011109529 BspA family leucine-rich repeat surface protein -
EF_RS10755 (EF2250) 2172738..2174870 - 2133 WP_010706530 WxL domain-containing protein -
EF_RS10760 (EF2252) 2174873..2175202 - 330 WP_002383571 LPXTG cell wall anchor domain-containing protein -
EF_RS10765 (EF2253) 2175207..2176256 - 1050 WP_002383570 DUF916 and DUF3324 domain-containing protein -
EF_RS10770 (EF2254) 2176313..2176981 - 669 WP_002359849 WxL domain-containing protein -
EF_RS10775 (EF2255) 2177344..2178453 - 1110 WP_002359848 site-specific integrase -
EF_RS10780 (EF2257) 2178943..2180244 - 1302 WP_002359847 PTS transporter subunit EIIC -
EF_RS10785 (EF2258) 2180257..2180874 - 618 WP_002387231 hypothetical protein -
EF_RS10790 (EF2259) 2180914..2181606 + 693 WP_002383568 SIS domain-containing protein -
EF_RS10795 (EF2260) 2181852..2182409 + 558 WP_002359842 hypothetical protein -
EF_RS10800 (EF2262) 2183317..2184111 - 795 WP_002359839 discoidin domain-containing protein -
EF_RS10805 (EF2263) 2184206..2185009 - 804 WP_002359838 gluconate 5-dehydrogenase -
EF_RS10810 (EF2264) 2185033..2185872 - 840 WP_002383567 5-dehydro-4-deoxy-D-glucuronate isomerase -
EF_RS10815 (EF2265) 2185899..2186900 - 1002 WP_002383566 sugar kinase -
EF_RS10820 (EF2266) 2186903..2187550 - 648 WP_002359835 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase -
EF_RS10825 (EF2267) 2187628..2188044 - 417 WP_010773786 PTS sugar transporter subunit IIA -
EF_RS10830 (EF2268) 2188057..2189985 - 1929 WP_002359832 alginate lyase family protein -
EF_RS10835 (EF2269) 2190127..2190942 - 816 WP_002359831 PTS system mannose/fructose/sorbose family transporter subunit IID -
EF_RS10840 (EF2270) 2190932..2191747 - 816 WP_002383564 PTS sugar transporter subunit IIC -
EF_RS10845 (EF2271) 2191777..2192277 - 501 WP_002359829 PTS sugar transporter subunit IIB -
EF_RS10850 (EF2272) 2192295..2193482 - 1188 WP_002359828 glycoside hydrolase family 88 protein -
EF_RS10855 (EF2273) 2193646..2194383 - 738 WP_002359827 GntR family transcriptional regulator -
EF_RS10860 (EF2276) 2195165..2196838 + 1674 WP_228841363 FUSC family protein -
EF_RS10865 (EF2277) 2197119..2198027 - 909 WP_010706532 conjugal transfer protein -
EF_RS10870 (EF2278) 2198027..2199049 - 1023 WP_002359823 bifunctional lysozyme/C40 family peptidase -
EF_RS10875 (EF2279) 2199046..2201160 - 2115 WP_002383559 FUSC family protein -
EF_RS10880 (EF2280) 2201166..2203613 - 2448 WP_002399809 ATP-binding protein -
EF_RS10885 (EF2281) 2203600..2203989 - 390 WP_002359820 conjugal transfer protein -
EF_RS10890 (EF2282) 2204066..2204680 + 615 WP_002359819 hypothetical protein -
EF_RS10895 2204696..2204893 + 198 Protein_2144 hypothetical protein -
EF_RS10900 (EF2283) 2204960..2206573 - 1614 WP_002368663 recombinase family protein -
EF_RS16605 (EF2284) 2206701..2206877 - 177 WP_002368665 hypothetical protein -
EF_RS10905 (EF2285) 2206945..2207805 - 861 WP_002368666 DUF6551 family protein -
EF_RS10910 (EF2286) 2207802..2209013 - 1212 WP_010773620 ParB N-terminal domain-containing protein -
EF_RS10915 2209618..2209935 - 318 WP_002368673 HTH domain-containing protein -
EF_RS10920 (EF2289) 2210145..2210591 - 447 WP_002368676 hypothetical protein -
EF_RS10925 (EF2290) 2210747..2211127 - 381 WP_002368678 sigma-70 family RNA polymerase sigma factor -
EF_RS10930 (EF2291) 2211601..2211966 + 366 WP_002368681 helix-turn-helix domain-containing protein -
EF_RS10935 (EF2293) 2212353..2212961 - 609 WP_002368685 D-Ala-D-Ala dipeptidase VanX -
EF_RS10940 (EF2294) 2212967..2213995 - 1029 WP_002368691 D-alanine--(R)-lactate ligase VanB -
EF_RS10945 (EF2295) 2213988..2214959 - 972 WP_002368693 D-lactate dehydrogenase VanH -
EF_RS10950 (EF2296) 2214956..2215783 - 828 WP_002368694 glycopeptide resistance accessory protein VanW-B -
EF_RS10955 (EF2297) 2215801..2216607 - 807 WP_002368695 D-Ala-D-Ala carboxypeptidase VanY-B -
EF_RS10960 (EF2298) 2216783..2218126 - 1344 WP_002368696 vancomycin resistance histidine kinase VanS-B -
EF_RS10965 (EF2299) 2218126..2218788 - 663 WP_002368697 vancomycin resistance response regulator transcription factor VanR-B -
EF_RS16830 2218921..2219031 - 111 Protein_2160 aminoglycoside 6-adenylyltransferase -
EF_RS10975 (EF2302) 2219565..2219753 - 189 WP_025186763 SymE family type I addiction module toxin -
EF_RS10980 2219735..2219923 - 189 WP_002368701 hypothetical protein -
EF_RS10985 (EF2303) 2220066..2221478 - 1413 WP_002368703 relaxase/mobilization nuclease domain-containing protein -
EF_RS10990 (EF2304) 2221592..2221834 + 243 WP_002368704 helix-turn-helix transcriptional regulator -
EF_RS10995 (EF2305) 2221837..2222787 - 951 WP_002368706 DUF3991 and toprim domain-containing protein -
EF_RS11000 (EF2306) 2222854..2223168 - 315 WP_229207000 plasmid mobilization relaxosome protein MobC -
EF_RS11005 (EF2307) 2223189..2232710 - 9522 WP_010774229 DEAD/DEAH box helicase family protein -
EF_RS11010 2232905..2233192 - 288 WP_244264353 hypothetical protein -
EF_RS11015 2233266..2233541 - 276 WP_002368711 hypothetical protein -
EF_RS11020 (EF2310) 2233538..2233987 - 450 WP_010773623 DUF4316 domain-containing protein -
EF_RS16835 (EF2311) 2233984..2234145 - 162 WP_011109534 hypothetical protein -
EF_RS16840 2234133..2234369 - 237 WP_244264354 helix-turn-helix domain-containing protein -
EF_RS11030 (EF2312) 2234375..2236492 - 2118 WP_002368714 DNA topoisomerase 3 -
EF_RS11035 2236670..2238907 - 2238 WP_002368715 DUF4366 domain-containing protein -
EF_RS11040 (EF2315) 2238911..2239159 - 249 WP_002368716 DUF4315 family protein -
EF_RS11045 (EF2316) 2239156..2240058 - 903 WP_002368717 radical SAM protein -
EF_RS11050 (EF2318) 2240101..2242878 - 2778 WP_010773625 CD1108 family mobile element protein cd419a
EF_RS11055 (EF2319) 2242875..2243990 - 1116 WP_010773626 DUF6674 family protein -
EF_RS11060 (EF2320) 2244004..2246481 - 2478 WP_010773627 VirB4-like conjugal transfer ATPase, CD1110 family virb4
EF_RS11065 (EF2321) 2246405..2246824 - 420 WP_002368721 PrgI family protein prgIa
EF_RS11070 (EF2322) 2246825..2248129 - 1305 WP_010773628 DUF3848 domain-containing protein -
EF_RS11075 (EF2323) 2248148..2248712 - 565 Protein_2182 MT-A70 family methyltransferase -
EF_RS11080 (EF2324) 2248728..2249597 - 870 WP_002368724 VirB6/TrbL-like conjugal transfer protein, CD1112 family prgHa
EF_RS11085 2249611..2249709 - 99 Protein_2184 Maff2 family protein -
EF_RS11090 (EF2326) 2249859..2251745 - 1887 WP_011109539 group II intron reverse transcriptase/maturase -
EF_RS11095 (EF2327) 2252468..2252596 - 129 Protein_2186 Maff2 family protein -
EF_RS11100 (EF2328) 2252661..2254436 - 1776 WP_002368726 VirD4-like conjugal transfer protein, CD1115 family -
EF_RS11105 (EF2329) 2254433..2254912 - 480 WP_002368727 PcfB family protein cd411
EF_RS11110 (EF2330) 2254941..2255447 - 507 WP_002368728 hypothetical protein -
EF_RS11115 (EF2331) 2255485..2255916 - 432 WP_002368729 hypothetical protein -
EF_RS11120 (EF2332) 2255995..2256822 - 828 WP_010773630 phosphoadenosine phosphosulfate reductase family protein -
EF_RS11125 (EF2333) 2256825..2257283 - 459 WP_002368731 DUF3846 domain-containing protein -
EF_RS11130 (EF2334) 2257334..2258320 - 987 WP_002368732 DUF6017 domain-containing protein -
EF_RS16845 2258580..2258963 + 384 Protein_2194 hypothetical protein -
EF_RS11140 (EF2335) 2258996..2259496 - 501 WP_002359817 antirestriction protein ArdA -
EF_RS11145 (EF2336) 2259509..2259730 - 222 WP_002298822 hypothetical protein orf19
EF_RS11150 (EF2337) 2259735..2259872 - 138 WP_002359816 DUF3789 domain-containing protein -
EF_RS11155 (EF2338) 2259869..2261053 - 1185 WP_002359815 MobT family relaxase -
EF_RS11160 (EF2339) 2261311..2261565 - 255 WP_002359814 hypothetical protein -
EF_RS11165 (EF2340) 2261591..2262733 - 1143 WP_002387062 DNA (cytosine-5-)-methyltransferase -
EF_RS11170 (EF2341) 2262814..2263635 - 822 WP_002359810 hypothetical protein -
EF_RS11175 (EF2342) 2263625..2264083 - 459 WP_002359809 hypothetical protein -
EF_RS11180 (EF2343) 2264189..2265535 - 1347 WP_002399949 FtsK/SpoIIIE domain-containing protein virb4
EF_RS11185 (EF2344) 2265603..2265947 - 345 WP_002359807 hypothetical protein -
EF_RS11190 (EF2345) 2265957..2266328 - 372 WP_002359806 YdcP family protein orf23
EF_RS11195 (EF2346) 2266341..2266655 - 315 WP_002383555 YdcP family protein orf23
EF_RS11200 (EF2347) 2266768..2269992 - 3225 WP_010774232 fibrinogen-binding MSCRAMM adhesin Fss3 -
EF_RS11205 (EF2348) 2270275..2272107 - 1833 WP_002387067 ATP-binding protein virb4
EF_RS11210 (EF2349) 2272094..2273473 - 1380 WP_002383549 SIR2 family protein -
EF_RS11215 (EF2350) 2273574..2274503 - 930 WP_002359794 helix-turn-helix transcriptional regulator -
EF_RS11220 (EF2352) 2274702..2276537 - 1836 WP_010706535 translation elongation factor 4 -


Host bacterium


ID   269 Element type   ICE (Integrative and conjugative element)
Element name   ICE_EfalV583_lepA GenBank   NC_004668
Element size   3218031 bp Coordinate of oriT [Strand]   97367..97409 [+]
Host bacterium   Enterococcus faecalis V583 Coordinate of element   2163705..2274732

Cargo genes


Drug resistance gene   VanHBX
Virulence gene   fss3
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21