Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 200300 |
Name | oriT_ICE_EfalV583_rplS |
Organism | Enterococcus faecalis V583 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NC_004668 (97367..97409 [+], 43 nt) |
oriT length | 43 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 43 nt
>oriT_ICE_EfalV583_rplS
CAAGGTGTTAACTTTTTCAAATGAGTTAACACCTATGCAAATT
CAAGGTGTTAACTTTTTCAAATGAGTTAACACCTATGCAAATT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 14337 | GenBank | WP_002360076 |
Name | mobT_EF_RS09055_ICE_EfalV583_rplS | UniProt ID | A0A828QMN8 |
Length | 394 a.a. | PDB ID | |
Note | Predicted by oriTfinder 2.0 |
Relaxase protein sequence
Download Length: 394 a.a. Molecular weight: 46486.49 Da Isoelectric Point: 9.1990
>WP_002360076.1 MULTISPECIES: MobT family relaxase [Lactobacillales]
MVQRNLDYRLLKDRRNEYGISQNKLATACGLSRPYLNQIENGGVTASTKTMRKIFNQLESFNPDLPLSLL
FDYVRIRFPTTDARKIIQEILHLKFDYMLHEDYAFYSYQEQYVMGDIVVMLSHEEDKGVLLELKGRGCRQ
FETFLLAQKRSWYDFFEDCLKAGGVMKRLDLAINDLVGLLDIPDLTKKCQKEECISLFRTFKSYRSGELL
KADEKDGMGNTLYIGSLKSEVYFCLYEKDYEQYIKLGIPLDKTETKNRFEIRLKNDRAYHAIQDLLKGRS
IESTTFSIINRYLRFADKVEGKRRTNWPLNEQWGRFIGRNRKEIQLTSEPKPYTIERTLNWLGRQVAPTW
KMAKELDRLNQTTYIQDMVQNARLSDRHKKILEQQSMAIENLII
MVQRNLDYRLLKDRRNEYGISQNKLATACGLSRPYLNQIENGGVTASTKTMRKIFNQLESFNPDLPLSLL
FDYVRIRFPTTDARKIIQEILHLKFDYMLHEDYAFYSYQEQYVMGDIVVMLSHEEDKGVLLELKGRGCRQ
FETFLLAQKRSWYDFFEDCLKAGGVMKRLDLAINDLVGLLDIPDLTKKCQKEECISLFRTFKSYRSGELL
KADEKDGMGNTLYIGSLKSEVYFCLYEKDYEQYIKLGIPLDKTETKNRFEIRLKNDRAYHAIQDLLKGRS
IESTTFSIINRYLRFADKVEGKRRTNWPLNEQWGRFIGRNRKEIQLTSEPKPYTIERTLNWLGRQVAPTW
KMAKELDRLNQTTYIQDMVQNARLSDRHKKILEQQSMAIENLII
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828QMN8 |
T4CP
ID | 16830 | GenBank | WP_002298803 |
Name | tcpA_EF_RS09075_ICE_EfalV583_rplS | UniProt ID | _ |
Length | 338 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 338 a.a. Molecular weight: 39619.99 Da Isoelectric Point: 6.5901
>WP_002298803.1 MULTISPECIES: FtsK/SpoIIIE domain-containing protein [Lactobacillales]
MYKEHRIRARDQHLVYHFILGWLIALLISWMGVFYFQEFRQFDISRVSLSTIETVWSMKELICLLGSLGF
SGAMLLLYIHFFPDHWRSLWHRQKLARMILENHWYEVKQTQSEGFFKDLNSSRTRETISYFPKIYYRMKE
GLLSIRVQISLGKYQEQLLKLEKKLESGLYCELVEKELKDSYVEYTLLYDMIANRIGIDEVVAENGTLRL
MKNQVWAYDSLPHMLIAGGTGGGKTYFLLTIIEALLKSDAELFILDPKNADLADLGTVMPHVYSQKEEIS
ACVEDFYERMIARSKAMKEMPNYKPGENYAYLGLPPNFLIFDEYVAYMGANRFPTSIE
MYKEHRIRARDQHLVYHFILGWLIALLISWMGVFYFQEFRQFDISRVSLSTIETVWSMKELICLLGSLGF
SGAMLLLYIHFFPDHWRSLWHRQKLARMILENHWYEVKQTQSEGFFKDLNSSRTRETISYFPKIYYRMKE
GLLSIRVQISLGKYQEQLLKLEKKLESGLYCELVEKELKDSYVEYTLLYDMIANRIGIDEVVAENGTLRL
MKNQVWAYDSLPHMLIAGGTGGGKTYFLLTIIEALLKSDAELFILDPKNADLADLGTVMPHVYSQKEEIS
ACVEDFYERMIARSKAMKEMPNYKPGENYAYLGLPPNFLIFDEYVAYMGANRFPTSIE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1819850..2272107
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EF_RS17045 (EF1870) | 1815784..1816680 | - | 897 | Protein_1759 | 4Fe-4S binding protein | - |
EF_RS08980 (EF1871) | 1816673..1817158 | - | 486 | WP_002330914 | TlpA disulfide reductase family protein | - |
EF_RS08985 (EF1872) | 1817314..1817724 | - | 411 | WP_002364129 | hypothetical protein | - |
EF_RS16790 | 1818110..1818484 | + | 375 | Protein_1762 | plasmid mobilization relaxosome protein MobC | - |
EF_RS08995 (EF1874) | 1818555..1819745 | + | 1191 | WP_002330912 | IS256-like element ISLgar5 family transposase | - |
EF_RS09000 (EF1875) | 1819850..1820761 | - | 912 | WP_010774217 | conjugal transfer protein | orf13 |
EF_RS09005 (EF1876) | 1820780..1821784 | - | 1005 | WP_002298830 | bifunctional lysozyme/C40 family peptidase | orf14 |
EF_RS09010 (EF1877) | 1821781..1823904 | - | 2124 | WP_002330911 | transposase | orf15 |
EF_RS09015 (EF1878) | 1823909..1826356 | - | 2448 | WP_002330910 | ATP-binding protein | virb4 |
EF_RS09020 (EF1879) | 1826343..1826732 | - | 390 | WP_002298826 | conjugal transfer protein | orf17a |
EF_RS09025 (EF1880) | 1826784..1827524 | + | 741 | WP_002383098 | hypothetical protein | - |
EF_RS09030 (EF1881) | 1827531..1828367 | - | 837 | WP_002360078 | abortive infection family protein | - |
EF_RS09035 (EF1882) | 1828432..1828935 | - | 504 | WP_002369218 | antirestriction protein ArdA | - |
EF_RS09040 (EF1883) | 1828948..1829169 | - | 222 | WP_002298822 | hypothetical protein | orf19 |
EF_RS09045 (EF1884) | 1829566..1830816 | + | 1251 | WP_002346915 | IS110 family transposase | - |
EF_RS09050 (EF1885) | 1830948..1831082 | - | 135 | WP_002330905 | DUF3789 domain-containing protein | - |
EF_RS09055 (EF1886) | 1831079..1832263 | - | 1185 | WP_002360076 | MobT family relaxase | - |
EF_RS16570 (EF1887) | 1832612..1832779 | - | 168 | WP_002298811 | hypothetical protein | - |
EF_RS09060 (EF1889) | 1832772..1833447 | - | 676 | Protein_1777 | zeta toxin family protein | - |
EF_RS09065 (EF1890) | 1833534..1833920 | - | 387 | Protein_1778 | ATP-binding protein | - |
EF_RS16795 | 1833992..1834483 | - | 492 | WP_002384398 | HNH endonuclease signature motif containing protein | - |
EF_RS16800 | 1834651..1835802 | - | 1152 | WP_224561186 | group II intron reverse transcriptase/maturase | - |
EF_RS09075 (EF1892) | 1836459..1837475 | - | 1017 | WP_002298803 | FtsK/SpoIIIE domain-containing protein | virb4 |
EF_RS09080 (EF1893) | 1837545..1837889 | - | 345 | WP_002369217 | hypothetical protein | - |
EF_RS09085 (EF1894) | 1837899..1838273 | - | 375 | WP_002298800 | YdcP family protein | orf23 |
EF_RS09090 (EF1895) | 1838286..1838600 | - | 315 | WP_002298798 | YdcP family protein | orf23 |
EF_RS09095 (EF1896) | 1838713..1841940 | - | 3228 | WP_002369215 | fibrinogen-binding MSCRAMM adhesin Fss3 | - |
EF_RS09100 (EF1897) | 1842020..1842682 | - | 663 | WP_002298795 | hypothetical protein | - |
EF_RS09105 (EF1898) | 1843053..1843400 | - | 348 | WP_002357176 | 50S ribosomal protein L19 | - |
EF_RS09110 (EF1899) | 1843544..1844284 | - | 741 | WP_002381776 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
EF_RS09115 (EF1900) | 1844274..1844798 | - | 525 | WP_002369214 | ribosome maturation factor RimM | - |
EF_RS09120 (EF1901) | 1844906..1846267 | - | 1362 | WP_002369213 | Nramp family divalent metal transporter | - |
EF_RS09125 (EF1902) | 1846464..1846838 | + | 375 | WP_002383105 | VOC family protein | - |
EF_RS09130 (EF1903) | 1847069..1847668 | + | 600 | WP_002357169 | VTT domain-containing protein | - |
EF_RS09135 (EF1904) | 1847769..1849571 | + | 1803 | WP_002369211 | glycerophosphodiester phosphodiesterase | - |
EF_RS09140 (EF1906) | 1849760..1850446 | - | 687 | WP_002357165 | Bax inhibitor-1/YccA family protein | - |
EF_RS09145 (EF1907) | 1850439..1850924 | - | 486 | WP_002357164 | MaoC/PaaZ C-terminal domain-containing protein | - |
EF_RS09150 (EF1908) | 1851122..1852459 | - | 1338 | WP_002357163 | UDP-N-acetylmuramate--L-alanine ligase | - |
EF_RS09155 (EF1909) | 1852614..1853567 | - | 954 | WP_002360064 | hypothetical protein | - |
EF_RS09160 (EF1910) | 1853685..1854644 | - | 960 | WP_002360063 | aromatic acid exporter family protein | - |
EF_RS09165 (EF1911) | 1854747..1855358 | + | 612 | WP_002365791 | aromatic acid exporter family protein | - |
EF_RS09170 (EF1912) | 1855399..1856280 | - | 882 | WP_002360061 | ROK family protein | - |
EF_RS09175 (EF1913) | 1856283..1856585 | - | 303 | WP_002357157 | membrane protein insertion efficiency factor YidD | - |
EF_RS16575 (EF1915) | 1856763..1856915 | + | 153 | WP_002357156 | SPJ_0845 family protein | - |
EF_RS09180 (EF1916) | 1856932..1857513 | - | 582 | WP_002357155 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
EF_RS09185 (EF1917) | 1857611..1858864 | - | 1254 | WP_002357154 | ATP-dependent Clp protease ATP-binding subunit ClpX | - |
EF_RS09190 (EF1918) | 1859056..1860084 | + | 1029 | WP_002357153 | lactonase family protein | - |
EF_RS09195 (EF1919) | 1860163..1860651 | - | 489 | WP_002379553 | GNAT family N-acetyltransferase | - |
EF_RS09200 (EF1920) | 1860663..1862036 | - | 1374 | WP_002360057 | C4-dicarboxylate transporter DcuC | - |
EF_RS09205 (EF1921) | 1862053..1863006 | - | 954 | WP_002383111 | ribonucleoside hydrolase RihC | - |
EF_RS09210 (EF1922) | 1863153..1865066 | + | 1914 | WP_002383112 | PfkB family carbohydrate kinase | - |
EF_RS09215 (EF1923) | 1865185..1866692 | + | 1508 | Protein_1810 | helix-turn-helix domain-containing protein | - |
EF_RS09220 (EF1925) | 1866995..1867840 | - | 846 | WP_002379556 | hypothetical protein | - |
EF_RS09225 (EF1926) | 1867833..1868360 | - | 528 | WP_002387303 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
EF_RS09230 (EF1927) | 1868647..1869366 | - | 720 | WP_002357140 | MIP/aquaporin family protein | - |
EF_RS09235 (EF1928) | 1869374..1871203 | - | 1830 | WP_002379559 | type 1 glycerol-3-phosphate oxidase | - |
EF_RS09240 (EF1929) | 1871224..1872729 | - | 1506 | WP_002357138 | glycerol kinase GlpK | - |
EF_RS09245 (EF1931) | 1873006..1874472 | - | 1467 | WP_002383114 | helix-turn-helix domain-containing protein | - |
EF_RS09250 (EF1932) | 1874462..1875796 | - | 1335 | WP_002379561 | FAD-dependent oxidoreductase | - |
EF_RS09255 (EF1933) | 1875976..1876332 | + | 357 | WP_002357135 | hypothetical protein | - |
EF_RS16580 (EF1934) | 1876366..1876527 | + | 162 | WP_002383115 | hypothetical protein | - |
EF_RS09260 (EF1936) | 1876769..1877209 | - | 441 | WP_002387302 | hypothetical protein | - |
EF_RS09265 (EF1937) | 1877279..1877815 | - | 537 | WP_010774219 | GNAT family N-acetyltransferase | - |
EF_RS09270 (EF1938) | 1877885..1880590 | - | 2706 | WP_002377094 | cation-translocating P-type ATPase | - |
EF_RS09275 (EF1939) | 1880908..1881558 | - | 651 | WP_002383117 | membrane protein | - |
EF_RS09280 (EF1940) | 1881647..1882312 | + | 666 | WP_002379563 | transcriptional regulator YeiL | - |
EF_RS09285 (EF1941) | 1882384..1882779 | + | 396 | WP_002379564 | DUF3224 domain-containing protein | - |
EF_RS09290 (EF1943) | 1882889..1884070 | + | 1182 | WP_002365813 | multidrug effflux MFS transporter | - |
EF_RS09295 (EF1945) | 1884251..1886086 | - | 1836 | WP_002379566 | alkaline phosphatase family protein | - |
EF_RS16585 (EF1947) | 1886295..1886444 | + | 150 | WP_002357118 | hypothetical protein | - |
EF_RS09300 (EF1948) | 1886595..1886945 | + | 351 | WP_002357112 | DUF1801 domain-containing protein | - |
EF_RS09305 (EF1949) | 1886956..1887306 | - | 351 | WP_002360043 | DUF2200 domain-containing protein | - |
EF_RS09310 (EF1950) | 1887380..1888384 | - | 1005 | WP_010774220 | SIS domain-containing protein | - |
EF_RS09315 (EF1951) | 1888378..1889454 | - | 1077 | WP_002383119 | SIS domain-containing protein | - |
EF_RS09320 (EF1952) | 1889465..1890298 | - | 834 | WP_002383120 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EF_RS09325 (EF1953) | 1890279..1891070 | - | 792 | WP_002357107 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EF_RS09330 | 1891086..1891556 | - | 471 | WP_002357106 | PTS sugar transporter subunit IIB | - |
EF_RS09335 | 1891568..1891987 | - | 420 | WP_002389037 | PTS fructose transporter subunit IIA | - |
EF_RS09340 (EF1955) | 1892059..1894830 | - | 2772 | WP_002383122 | sigma-54-dependent transcriptional regulator | - |
EF_RS16805 (EF1956) | 1894974..1895189 | - | 216 | WP_002357102 | hypothetical protein | - |
EF_RS09345 (EF1958) | 1895401..1896762 | - | 1362 | WP_002357101 | deoxyguanosinetriphosphate triphosphohydrolase | - |
EF_RS09350 (EF1959) | 1896779..1897603 | - | 825 | WP_002357099 | toll/interleukin-1 receptor domain-containing protein | - |
EF_RS09355 (EF1961) | 1897956..1899254 | - | 1299 | WP_002357098 | phosphopyruvate hydratase | - |
EF_RS09360 (EF1962) | 1899386..1900141 | - | 756 | WP_002357096 | triose-phosphate isomerase | - |
EF_RS09365 (EF1963) | 1900190..1901383 | - | 1194 | WP_002357094 | phosphoglycerate kinase | - |
EF_RS09370 (EF1964) | 1901510..1902511 | - | 1002 | WP_002357093 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
EF_RS09375 (EF1965) | 1902551..1903588 | - | 1038 | WP_002357092 | sugar-binding domain-containing protein | - |
EF_RS09380 (EF1966) | 1904008..1904886 | - | 879 | WP_002357090 | YitT family protein | - |
EF_RS09385 (EF1967) | 1905029..1905598 | - | 570 | WP_002364165 | TIGR01440 family protein | - |
EF_RS09390 (EF1968) | 1905595..1906101 | - | 507 | WP_002357086 | ECF transporter S component | - |
EF_RS09395 (EF1969) | 1906085..1906921 | - | 837 | WP_002383128 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
EF_RS09400 (EF1970) | 1907075..1908844 | - | 1770 | WP_002379571 | aspartate--tRNA ligase | - |
EF_RS09405 (EF1971) | 1908862..1910163 | - | 1302 | WP_002366882 | histidine--tRNA ligase | - |
EF_RS16810 (EF1972) | 1910160..1910381 | - | 222 | WP_002383130 | hypothetical protein | - |
EF_RS09415 (EF1973) | 1910521..1910967 | - | 447 | WP_002357080 | D-aminoacyl-tRNA deacylase | - |
EF_RS09420 (EF1974) | 1910991..1913204 | - | 2214 | WP_002357079 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
EF_RS09425 (EF1975) | 1913419..1914171 | - | 753 | WP_002370972 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
EF_RS09430 (EF1976) | 1914173..1915120 | - | 948 | WP_011109511 | 50S ribosomal protein L11 methyltransferase | - |
EF_RS09435 (EF1977) | 1915136..1915621 | - | 486 | WP_002388170 | DUF3013 family protein | - |
EF_RS09440 (EF1978) | 1915578..1916255 | - | 678 | WP_002364174 | DNA-3-methyladenine glycosylase | - |
EF_RS09445 (EF1979) | 1916384..1917661 | + | 1278 | WP_011109512 | replication-associated recombination protein A | - |
EF_RS09455 (EF1980) | 1917935..1918267 | + | 333 | WP_002357068 | hypothetical protein | - |
EF_RS09460 (EF1982) | 1918585..1919058 | + | 474 | WP_002357065 | universal stress protein | - |
EF_RS09465 (EF1983) | 1919170..1920357 | - | 1188 | WP_002357064 | acetate kinase | - |
EF_RS09475 (EF1984) | 1920382..1921389 | - | 1008 | Protein_1863 | class I SAM-dependent methyltransferase | - |
EF_RS09480 (EF1985) | 1921518..1921871 | - | 354 | WP_002357061 | competence type IV pilus minor pilin ComGG | - |
EF_RS09485 (EF1986) | 1921871..1922305 | - | 435 | WP_002357060 | competence type IV pilus minor pilin ComGF | - |
EF_RS09490 (EF1987) | 1922295..1922696 | - | 402 | WP_002383134 | type II secretion system protein | - |
EF_RS16950 (EF1988) | 1923000..1923125 | + | 126 | WP_002364184 | hypothetical protein | - |
EF_RS09495 (EF1989) | 1923422..1924363 | - | 942 | WP_002364185 | ferrochelatase | - |
EF_RS09505 (EF1990) | 1925103..1925351 | - | 249 | WP_002383136 | hypothetical protein | - |
EF_RS09510 (EF1991) | 1925423..1925623 | - | 201 | WP_002357053 | cold-shock protein | - |
EF_RS09515 (EF1992) | 1926460..1927701 | - | 1242 | WP_002370962 | LysM peptidoglycan-binding domain-containing protein | - |
EF_RS09520 (EF1993) | 1927702..1927935 | - | 234 | WP_002384371 | phage holin | - |
EF_RS09525 | 1927928..1928149 | - | 222 | WP_002364191 | hypothetical protein | - |
EF_RS09530 (EF1994) | 1928184..1928339 | - | 156 | WP_002364192 | XkdX family protein | - |
EF_RS09535 (EF1995) | 1928341..1928661 | - | 321 | WP_002389262 | hypothetical protein | - |
EF_RS09540 (EF1996) | 1928675..1929166 | - | 492 | WP_002364194 | hypothetical protein | - |
EF_RS09545 | 1929166..1929453 | - | 288 | WP_002357046 | collagen-like protein | - |
EF_RS09550 (EF1998) | 1929450..1930046 | - | 597 | WP_002357045 | hypothetical protein | - |
EF_RS09555 (EF2000) | 1930039..1930921 | - | 883 | Protein_1879 | phage baseplate upper protein | - |
EF_RS09560 (EF2001) | 1930940..1933747 | - | 2808 | WP_002387289 | phage tail spike protein | - |
EF_RS09565 (EF2002) | 1933729..1934463 | - | 735 | WP_011109514 | tail protein | - |
EF_RS09570 (EF2003) | 1934453..1937350 | - | 2898 | WP_002387288 | tape measure protein | - |
EF_RS09575 (EF2004) | 1937598..1937948 | - | 351 | WP_002357039 | hypothetical protein | - |
EF_RS09580 (EF2005) | 1938001..1938849 | - | 849 | WP_002387287 | major tail protein | - |
EF_RS09585 (EF2006) | 1938850..1939224 | - | 375 | WP_002387286 | DUF6838 family protein | - |
EF_RS09590 (EF2007) | 1939227..1939625 | - | 399 | WP_002357036 | HK97 gp10 family phage protein | - |
EF_RS09595 (EF2008) | 1939618..1939992 | - | 375 | WP_002387285 | hypothetical protein | - |
EF_RS09600 (EF2009) | 1939989..1940333 | - | 345 | WP_002387282 | hypothetical protein | - |
EF_RS09605 (EF2010) | 1940347..1940529 | - | 183 | WP_002387281 | hypothetical protein | - |
EF_RS09610 (EF2011) | 1940558..1941445 | - | 888 | WP_002387280 | DUF5309 domain-containing protein | - |
EF_RS09615 (EF2012) | 1941459..1942082 | - | 624 | WP_010706493 | DUF4355 domain-containing protein | - |
EF_RS09620 (EF2013) | 1942301..1942621 | - | 321 | WP_002380436 | hypothetical protein | - |
EF_RS09625 (EF2014) | 1942678..1942908 | - | 231 | WP_002380437 | hypothetical protein | - |
EF_RS09630 (EF2015) | 1942909..1944813 | - | 1905 | WP_010706494 | head protein | - |
EF_RS09635 (EF2016) | 1944788..1946260 | - | 1473 | WP_010706495 | phage portal protein | - |
EF_RS09640 (EF2017) | 1946272..1947660 | - | 1389 | WP_002387276 | phage terminase large subunit | - |
EF_RS09645 (EF2018) | 1947653..1948114 | - | 462 | WP_002383816 | helix-turn-helix domain-containing protein | - |
EF_RS09650 (EF2019) | 1948190..1948366 | - | 177 | WP_010706496 | hypothetical protein | - |
EF_RS09655 (EF2020) | 1948550..1949362 | - | 813 | WP_002383813 | hypothetical protein | - |
EF_RS16590 (EF2021) | 1949474..1949707 | - | 234 | Protein_1900 | hypothetical protein | - |
EF_RS09660 | 1950515..1950760 | - | 246 | WP_010716537 | hypothetical protein | - |
EF_RS09665 (EF2022) | 1950785..1951708 | - | 924 | WP_002383810 | DUF6731 family protein | - |
EF_RS09675 (EF2024) | 1952426..1952842 | - | 417 | WP_010706497 | ArpU family phage packaging/lysis transcriptional regulator | - |
EF_RS09680 (EF2026) | 1953750..1954158 | - | 409 | Protein_1904 | RusA family crossover junction endodeoxyribonuclease | - |
EF_RS09685 (EF2027) | 1954155..1955012 | - | 858 | WP_002387271 | helix-turn-helix domain-containing protein | - |
EF_RS09690 (EF2028) | 1955012..1955212 | - | 201 | WP_002357010 | hypothetical protein | - |
EF_RS16815 | 1955217..1955600 | - | 384 | WP_002383802 | putative HNHc nuclease | - |
EF_RS16820 | 1955639..1955857 | - | 219 | WP_010774222 | hypothetical protein | - |
EF_RS09700 (EF2031) | 1955862..1956596 | - | 735 | WP_002383799 | ERF family protein | - |
EF_RS09705 (EF2032) | 1956589..1956906 | - | 318 | WP_002383798 | hypothetical protein | - |
EF_RS09710 (EF2034) | 1957102..1957440 | - | 339 | WP_002383796 | hypothetical protein | - |
EF_RS09715 | 1957477..1957686 | - | 210 | WP_002378465 | hypothetical protein | - |
EF_RS09720 (EF2036) | 1957741..1957929 | + | 189 | WP_002357001 | YegP family protein | - |
EF_RS09725 (EF2037) | 1957955..1958677 | - | 723 | WP_002387270 | phage regulatory protein | - |
EF_RS09730 (EF2038) | 1958700..1959011 | - | 312 | WP_002403885 | hypothetical protein | - |
EF_RS09735 (EF2039) | 1959023..1959214 | - | 192 | WP_002383936 | hypothetical protein | - |
EF_RS09740 (EF2040) | 1959510..1959851 | + | 342 | WP_002387267 | helix-turn-helix transcriptional regulator | - |
EF_RS09745 (EF2041) | 1959856..1960506 | + | 651 | WP_002387266 | ImmA/IrrE family metallo-endopeptidase | - |
EF_RS09750 (EF2042) | 1960602..1961231 | + | 630 | WP_002387265 | SHOCT domain-containing protein | - |
EF_RS09755 (EF2043) | 1961337..1962485 | + | 1149 | WP_002387264 | site-specific integrase | - |
EF_RS09760 | 1962522..1962956 | - | 435 | Protein_1921 | competence type IV pilus minor pilin ComGD | - |
EF_RS09765 (EF2044) | 1962953..1963228 | - | 276 | WP_002356991 | competence type IV pilus major pilin ComGC | - |
EF_RS09770 (EF2045) | 1963228..1964274 | - | 1047 | WP_002356990 | competence type IV pilus assembly protein ComGB | - |
EF_RS09775 (EF2046) | 1964231..1965199 | - | 969 | WP_002364362 | competence type IV pilus ATPase ComGA | - |
EF_RS09780 (EF2047) | 1965440..1966768 | - | 1329 | WP_002362058 | amino acid permease | - |
EF_RS09785 (EF2048) | 1967059..1968132 | - | 1074 | WP_002356987 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
EF_RS09790 (EF2049) | 1968257..1970086 | - | 1830 | WP_002383725 | ABC transporter permease | - |
EF_RS09795 (EF2050) | 1970076..1970825 | - | 750 | WP_002381711 | ABC transporter ATP-binding protein | - |
EF_RS09800 (EF2051) | 1970943..1971644 | - | 702 | WP_002364244 | GntR family transcriptional regulator | - |
EF_RS09805 (EF2052) | 1971775..1974198 | - | 2424 | WP_002364367 | DNA translocase FtsK | - |
EF_RS09810 (EF2055) | 1974512..1975723 | - | 1212 | WP_002360017 | NAD(P)/FAD-dependent oxidoreductase | - |
EF_RS09815 (EF2056) | 1975752..1976657 | - | 906 | WP_002360016 | prenyltransferase | - |
EF_RS09820 (EF2057) | 1976779..1977759 | + | 981 | WP_002360015 | polyprenyl synthetase family protein | - |
EF_RS09825 (EF2058) | 1977839..1979605 | - | 1767 | WP_002383727 | thiol reductant ABC exporter subunit CydC | - |
EF_RS09830 (EF2059) | 1979602..1981335 | - | 1734 | WP_002378477 | thiol reductant ABC exporter subunit CydD | - |
EF_RS09835 (EF2060) | 1981340..1982353 | - | 1014 | WP_002379582 | cytochrome d ubiquinol oxidase subunit II | - |
EF_RS09840 (EF2061) | 1982350..1983768 | - | 1419 | WP_002356974 | cytochrome ubiquinol oxidase subunit I | - |
EF_RS09845 (EF2063) | 1984500..1985363 | - | 864 | WP_002379583 | AraC family transcriptional regulator | - |
EF_RS09850 (EF2064) | 1985448..1987529 | - | 2082 | WP_002362072 | DNA topoisomerase III | - |
EF_RS09855 (EF2065) | 1987660..1988025 | - | 366 | WP_002356966 | DUF1033 family protein | - |
EF_RS09860 (EF2066) | 1988123..1988692 | - | 570 | WP_002379584 | TetR/AcrR family transcriptional regulator | - |
EF_RS09865 (EF2067) | 1988825..1989340 | + | 516 | WP_002379586 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
EF_RS09870 (EF2068) | 1989357..1990595 | + | 1239 | WP_002362074 | multidrug efflux MFS transporter | - |
EF_RS09875 (EF2070) | 1990775..1991899 | - | 1125 | WP_002362075 | tRNA 2-thiouridine(34) synthase MnmA | - |
EF_RS09880 (EF2071) | 1992125..1992469 | - | 345 | WP_002356959 | DUF1831 domain-containing protein | - |
EF_RS09885 (EF2072) | 1992537..1993682 | - | 1146 | WP_002360007 | cysteine desulfurase family protein | - |
EF_RS09890 (EF2073) | 1993839..1994813 | - | 975 | WP_002379587 | ribose-phosphate diphosphokinase | - |
EF_RS09895 (EF2074) | 1995027..1995776 | + | 750 | WP_002360005 | metal ABC transporter ATP-binding protein | - |
EF_RS09900 (EF2075) | 1995773..1996642 | + | 870 | WP_002364373 | metal ABC transporter permease | - |
EF_RS09905 (EF2076) | 1996629..1997555 | + | 927 | WP_002356954 | metal ABC transporter substrate-binding protein | - |
EF_RS09910 (EF2077) | 1997610..1999148 | - | 1539 | WP_002362078 | ABC-F family ATP-binding cassette domain-containing protein | - |
EF_RS09915 (EF2079) | 1999518..2000711 | - | 1194 | WP_002383734 | amidohydrolase | - |
EF_RS09920 (EF2080) | 2000726..2001559 | - | 834 | WP_002383735 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
EF_RS09925 (EF2081) | 2001579..2002259 | - | 681 | WP_002359998 | methionine ABC transporter permease | - |
EF_RS09930 (EF2082) | 2002278..2003348 | - | 1071 | WP_002356948 | methionine ABC transporter ATP-binding protein | - |
EF_RS09940 (EF2084) | 2004910..2005158 | + | 249 | WP_002359996 | hypothetical protein | - |
EF_RS09945 (EF2085) | 2005177..2006145 | - | 969 | WP_002359995 | Abi family protein | - |
EF_RS09955 (EF2086) | 2006956..2007957 | - | 1002 | WP_002399567 | GH25 family lysozyme | - |
EF_RS09960 (EF2087) | 2007929..2008207 | - | 279 | WP_002359993 | phage holin family protein | - |
EF_RS09965 (EF2088) | 2008207..2008461 | - | 255 | WP_002359992 | hypothetical protein | - |
EF_RS09970 (EF2089) | 2008474..2008893 | - | 420 | WP_002359991 | XkdX family protein | - |
EF_RS09975 (EF2090) | 2008881..2009741 | - | 861 | WP_002399568 | collagen-like protein | - |
EF_RS09980 (EF2091) | 2009728..2010216 | - | 489 | WP_002359989 | hypothetical protein | - |
EF_RS09985 (EF2092) | 2010229..2010921 | - | 693 | WP_002359987 | hypothetical protein | - |
EF_RS09990 (EF2093) | 2010918..2013494 | - | 2577 | WP_002359986 | phage tail tip lysozyme | - |
EF_RS09995 (EF2094) | 2013531..2014433 | - | 903 | WP_010706507 | hypothetical protein | - |
EF_RS10000 (EF2095) | 2014448..2015563 | - | 1116 | WP_002399570 | hypothetical protein | - |
EF_RS10005 (EF2096) | 2015568..2020730 | - | 5163 | WP_002399571 | tape measure protein | - |
EF_RS10010 (EF2097) | 2020731..2021036 | - | 306 | WP_002359982 | hypothetical protein | - |
EF_RS10015 (EF2098) | 2021039..2021623 | - | 585 | WP_002359981 | hypothetical protein | - |
EF_RS10020 (EF2099) | 2021650..2022984 | - | 1335 | WP_002399573 | hypothetical protein | - |
EF_RS10025 (EF2100) | 2023000..2023440 | - | 441 | WP_002359979 | immunoglobulin-like domain-containing protein | - |
EF_RS10030 (EF2101) | 2023453..2023842 | - | 390 | WP_002359978 | hypothetical protein | - |
EF_RS10035 (EF2102) | 2023843..2024058 | - | 216 | WP_002359976 | hypothetical protein | - |
EF_RS10040 (EF2103) | 2024055..2024762 | - | 708 | WP_002359974 | hypothetical protein | - |
EF_RS10045 (EF2104) | 2024782..2025960 | - | 1179 | WP_002359973 | hypothetical protein | - |
EF_RS10050 (EF2105) | 2025964..2026995 | - | 1032 | WP_002399574 | hypothetical protein | - |
EF_RS10055 (EF2106) | 2026997..2027305 | - | 309 | WP_002359971 | hypothetical protein | - |
EF_RS10060 (EF2107) | 2027302..2027481 | - | 180 | WP_002359970 | hypothetical protein | - |
EF_RS10065 (EF2108) | 2027499..2027828 | - | 330 | WP_002359968 | hypothetical protein | - |
EF_RS10070 (EF2109) | 2027848..2028429 | - | 582 | WP_002359967 | hypothetical protein | - |
EF_RS10075 (EF2110) | 2028413..2028943 | - | 531 | WP_002359966 | hypothetical protein | - |
EF_RS10080 (EF2111) | 2028940..2030220 | - | 1281 | WP_002359965 | hypothetical protein | - |
EF_RS10085 (EF2112) | 2030238..2031797 | - | 1560 | WP_002380477 | terminase family protein | - |
EF_RS10090 (EF2113) | 2031763..2032182 | - | 420 | WP_002393641 | KGG domain-containing protein | - |
EF_RS10095 (EF2114) | 2032172..2033374 | - | 1203 | WP_002399577 | DNA modification methylase | - |
EF_RS10105 (EF2115) | 2033782..2034207 | - | 426 | WP_002359961 | ArpU family phage packaging/lysis transcriptional regulator | - |
EF_RS10110 (EF2117) | 2034506..2034706 | - | 201 | WP_002359960 | hypothetical protein | - |
EF_RS10115 (EF2118) | 2034720..2035274 | - | 555 | WP_002399578 | DUF3850 domain-containing protein | - |
EF_RS10120 (EF2119) | 2035274..2035591 | - | 318 | WP_010714055 | hypothetical protein | - |
EF_RS16825 (EF2120) | 2035759..2036301 | - | 543 | WP_002399580 | hypothetical protein | - |
EF_RS10135 (EF2121) | 2036326..2036550 | - | 225 | WP_002399581 | hypothetical protein | - |
EF_RS10140 (EF2123) | 2036640..2036852 | - | 213 | WP_002399583 | hypothetical protein | - |
EF_RS10145 (EF2124) | 2036930..2037412 | - | 483 | WP_011109521 | class I SAM-dependent methyltransferase | - |
EF_RS16600 | 2037559..2037702 | - | 144 | WP_021733001 | hypothetical protein | - |
EF_RS10150 (EF2126) | 2037719..2038069 | - | 351 | WP_010714057 | hypothetical protein | - |
EF_RS10155 (EF2127) | 2038081..2038413 | - | 333 | WP_002399587 | hypothetical protein | - |
EF_RS10160 (EF2128) | 2038410..2038835 | - | 426 | WP_010774223 | RusA family crossover junction endodeoxyribonuclease | - |
EF_RS10165 (EF2129) | 2038844..2039713 | - | 870 | WP_002399589 | ATP-binding protein | - |
EF_RS10170 (EF2130) | 2039727..2040578 | - | 852 | WP_010714058 | Lin1244/Lin1753 domain-containing protein | - |
EF_RS10175 (EF2131) | 2040592..2041410 | - | 819 | WP_002399591 | PD-(D/E)XK nuclease-like domain-containing protein | - |
EF_RS10180 (EF2132) | 2041370..2042293 | - | 924 | WP_002399592 | RecT family recombinase | - |
EF_RS10185 (EF2133) | 2042283..2042615 | - | 333 | WP_010706514 | hypothetical protein | - |
EF_RS10190 (EF2134) | 2042638..2042928 | - | 291 | WP_002399594 | hypothetical protein | - |
EF_RS10195 (EF2135) | 2043013..2043339 | - | 327 | WP_002399595 | hypothetical protein | - |
EF_RS10200 (EF2136) | 2043340..2043549 | - | 210 | WP_002359948 | hypothetical protein | - |
EF_RS10205 (EF2138) | 2043692..2043943 | - | 252 | WP_002359946 | helix-turn-helix transcriptional regulator | - |
EF_RS10210 (EF2139) | 2043958..2044485 | - | 528 | WP_002399596 | hypothetical protein | - |
EF_RS10215 (EF2140) | 2044543..2044716 | - | 174 | WP_002415790 | hypothetical protein | - |
EF_RS10220 (EF2141) | 2044730..2044951 | - | 222 | WP_002399598 | helix-turn-helix transcriptional regulator | - |
EF_RS10225 (EF2142) | 2045101..2045460 | + | 360 | WP_002399599 | helix-turn-helix transcriptional regulator | - |
EF_RS10230 (EF2143) | 2045470..2045937 | + | 468 | WP_002399600 | ImmA/IrrE family metallo-endopeptidase | - |
EF_RS10235 (EF2144) | 2045958..2046818 | + | 861 | WP_010712986 | lipoprotein | - |
EF_RS10240 (EF2145) | 2047004..2048146 | + | 1143 | WP_010774224 | site-specific integrase | - |
EF_RS10245 (EF2146) | 2048429..2049919 | + | 1491 | WP_002383738 | glucosyltransferase domain-containing protein | - |
EF_RS10250 (EF2147) | 2050132..2050311 | + | 180 | WP_002383739 | hypothetical protein | - |
EF_RS10255 (EF2148) | 2050399..2051364 | - | 966 | WP_002379592 | hypothetical protein | - |
EF_RS10260 (EF2149) | 2051540..2051830 | - | 291 | WP_002379593 | hypothetical protein | - |
EF_RS10265 (EF2150) | 2051878..2053116 | - | 1239 | WP_002379594 | aminoacyltransferase | - |
EF_RS10270 (EF2151) | 2053427..2055235 | - | 1809 | WP_002383741 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
EF_RS10275 (EF2152) | 2055678..2056511 | - | 834 | WP_002356939 | energy-coupling factor transporter transmembrane component T | - |
EF_RS10280 (EF2153) | 2056508..2058214 | - | 1707 | WP_002380507 | ABC transporter ATP-binding protein | - |
EF_RS10285 (EF2154) | 2058315..2058866 | - | 552 | WP_002356937 | ECF-type riboflavin transporter substrate-binding protein | - |
EF_RS10290 (EF2155) | 2059096..2060449 | - | 1354 | Protein_2024 | phosphoglucosamine mutase | - |
EF_RS10295 (EF2156) | 2060442..2061605 | - | 1164 | WP_002379597 | CdaR family protein | - |
EF_RS10300 (EF2157) | 2061602..2062486 | - | 885 | WP_002389035 | diadenylate cyclase CdaA | - |
EF_RS10305 (EF2158) | 2062683..2066414 | - | 3732 | WP_002383743 | pyruvate:ferredoxin (flavodoxin) oxidoreductase | - |
EF_RS10310 (EF2159) | 2066672..2068012 | - | 1341 | WP_002356929 | type I glutamate--ammonia ligase | - |
EF_RS10315 (EF2160) | 2068055..2068438 | - | 384 | WP_002388239 | MerR family transcriptional regulator | - |
EF_RS10320 (EF2161) | 2068641..2069882 | - | 1242 | WP_002379600 | GTPase HflX | - |
EF_RS10325 (EF2162) | 2069886..2070815 | - | 930 | WP_002366931 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
EF_RS10330 (EF2163) | 2070816..2071562 | - | 747 | WP_002379601 | glycerophosphodiester phosphodiesterase | - |
EF_RS10335 (EF2164) | 2071671..2073482 | - | 1812 | WP_010774225 | DUF6056 family protein | - |
EF_RS10340 (EF2165) | 2073479..2074453 | - | 975 | WP_002383748 | GDP-mannose 4,6-dehydratase | - |
EF_RS10345 (EF2166) | 2074545..2075966 | - | 1422 | WP_002380514 | hypothetical protein | - |
EF_RS10350 (EF2167) | 2075977..2076948 | - | 972 | WP_002383749 | glycosyltransferase family 2 protein | - |
EF_RS10355 (EF2168) | 2076988..2077812 | - | 825 | WP_002379605 | LicD family protein | - |
EF_RS10360 (EF2169) | 2077867..2079297 | - | 1431 | WP_002379606 | O-antigen ligase family protein | - |
EF_RS10365 (EF2170) | 2079338..2080312 | - | 975 | WP_002383750 | glycosyltransferase | - |
EF_RS10370 (EF2171) | 2080314..2081372 | - | 1059 | WP_002383751 | NAD-dependent epimerase/dehydratase family protein | - |
EF_RS10375 (EF2172) | 2081385..2082089 | - | 705 | WP_002380521 | IspD/TarI family cytidylyltransferase | - |
EF_RS10380 (EF2173) | 2082363..2083541 | + | 1179 | WP_000997695 | IS256-like element ISEf1 family transposase | - |
EF_RS10385 (EF2174) | 2083902..2086583 | - | 2682 | WP_002383753 | DUF5776 domain-containing protein | - |
EF_RS10390 (EF2175) | 2086827..2087675 | - | 849 | WP_002379609 | LicD family protein | - |
EF_RS10395 (EF2176) | 2087691..2088449 | - | 759 | WP_002379610 | glycosyltransferase family 2 protein | - |
EF_RS10400 (EF2177) | 2088584..2089981 | - | 1398 | WP_002356909 | sugar transferase | - |
EF_RS10405 (EF2178) | 2090087..2091388 | - | 1302 | WP_002383757 | EpaQ family protein | - |
EF_RS10410 (EF2179) | 2091417..2093420 | - | 2004 | WP_002383759 | hypothetical protein | - |
EF_RS10415 (EF2180) | 2093421..2095562 | - | 2142 | WP_002378512 | glycosyltransferase family 2 protein | - |
EF_RS10420 (EF2181) | 2095574..2098717 | - | 3144 | WP_002383762 | glycosyltransferase | - |
EF_RS10425 (EF2182) | 2098707..2099924 | - | 1218 | WP_002356901 | ABC transporter ATP-binding protein | - |
EF_RS10430 (EF2183) | 2099937..2100731 | - | 795 | WP_002356900 | ABC transporter permease | - |
EF_RS10435 (EF2184) | 2100979..2101320 | + | 342 | WP_002356899 | EamA family transporter | - |
EF_RS10440 (EF2185) | 2101597..2102775 | + | 1179 | WP_000997695 | IS256-like element ISEf1 family transposase | - |
EF_RS10445 (EF2186) | 2102800..2103051 | - | 252 | WP_011109525 | hypothetical protein | - |
EF_RS10450 (EF2187) | 2103109..2104281 | - | 1173 | WP_000195429 | IS256-like element IS256 family transposase | - |
EF_RS10455 (EF2188) | 2104378..2105082 | - | 705 | WP_011109526 | acyltransferase family protein | - |
EF_RS10460 (EF2189) | 2105075..2105440 | - | 366 | WP_002379614 | DUF2304 domain-containing protein | - |
EF_RS10465 (EF2190) | 2105440..2106165 | - | 726 | WP_002379615 | glycosyltransferase family 2 protein | - |
EF_RS10470 (EF2191) | 2106224..2107066 | - | 843 | WP_002379616 | dTDP-4-dehydrorhamnose reductase | - |
EF_RS10475 (EF2192) | 2107159..2108187 | - | 1029 | WP_002359895 | dTDP-glucose 4,6-dehydratase | - |
EF_RS10480 (EF2193) | 2108212..2108784 | - | 573 | WP_002356893 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
EF_RS10485 (EF2194) | 2108797..2109663 | - | 867 | WP_002364387 | glucose-1-phosphate thymidylyltransferase RfbA | - |
EF_RS10490 (EF2195) | 2109785..2110498 | - | 714 | WP_002362119 | glycosyltransferase family 2 protein | - |
EF_RS10495 (EF2196) | 2110502..2111329 | - | 828 | WP_002383764 | glycosyltransferase | - |
EF_RS10500 (EF2197) | 2111329..2112117 | - | 789 | WP_002383765 | glycosyltransferase family 2 protein | - |
EF_RS10505 (EF2198) | 2112239..2113375 | - | 1137 | WP_002366956 | MraY family glycosyltransferase | - |
EF_RS10510 (EF2199) | 2113486..2114394 | - | 909 | WP_002383768 | YihY/virulence factor BrkB family protein | - |
EF_RS10515 (EF2200) | 2114410..2115174 | - | 765 | WP_002356886 | type I methionyl aminopeptidase | - |
EF_RS10520 (EF2201) | 2115349..2115792 | + | 444 | WP_002356885 | flavodoxin | - |
EF_RS10525 (EF2202) | 2115867..2116340 | - | 474 | WP_002383769 | TspO/MBR family protein | - |
EF_RS10530 (EF2203) | 2116498..2117070 | - | 573 | WP_002356883 | TetR/AcrR family transcriptional regulator | - |
EF_RS10535 (EF2204) | 2117321..2118558 | + | 1238 | Protein_2073 | aminopeptidase | - |
EF_RS10540 (EF2205) | 2118818..2119198 | + | 381 | WP_002383771 | PH domain-containing protein | - |
EF_RS10550 (EF2206) | 2119416..2119937 | - | 522 | WP_002362126 | tRNA adenosine(34) deaminase TadA | - |
EF_RS10555 (EF2207) | 2120015..2120866 | + | 852 | WP_002383772 | helix-turn-helix domain-containing protein | - |
EF_RS10560 (EF2208) | 2120923..2121768 | + | 846 | WP_002372093 | PhzF family phenazine biosynthesis protein | - |
EF_RS10565 (EF2209) | 2121795..2122133 | - | 339 | WP_002356871 | hypothetical protein | - |
EF_RS10570 (EF2210) | 2122217..2122921 | - | 705 | WP_002383773 | zinc metallopeptidase | - |
EF_RS10575 (EF2211) | 2123120..2123473 | + | 354 | WP_002387247 | YxeA family protein | - |
EF_RS10580 (EF2212) | 2123511..2124515 | - | 1005 | WP_002387246 | nucleoid-associated protein | - |
EF_RS10585 (EF2213) | 2124643..2126109 | - | 1467 | WP_002383776 | PTS system trehalose-specific EIIBC component | - |
EF_RS10590 (EF2214) | 2126321..2126701 | + | 381 | WP_002383777 | VOC family protein | - |
EF_RS10595 (EF2215) | 2126723..2127205 | + | 483 | WP_002356863 | SRPBCC family protein | - |
EF_RS10600 (EF2216) | 2127249..2128361 | - | 1113 | WP_002383778 | FUSC family protein | - |
EF_RS10605 (EF2217) | 2128534..2130675 | + | 2142 | WP_002374433 | GH92 family glycosyl hydrolase | - |
EF_RS10610 (EF2218) | 2130716..2132197 | - | 1482 | WP_002387242 | response regulator transcription factor | - |
EF_RS10615 (EF2219) | 2132209..2133939 | - | 1731 | WP_002387241 | sensor histidine kinase | - |
EF_RS10620 (EF2220) | 2133893..2134528 | - | 636 | WP_002362905 | DUF624 domain-containing protein | - |
EF_RS10625 (EF2221) | 2134599..2136065 | - | 1467 | WP_002370392 | ABC transporter substrate-binding protein | - |
EF_RS10630 (EF2222) | 2136089..2137012 | - | 924 | WP_002359877 | carbohydrate ABC transporter permease | - |
EF_RS10635 (EF2223) | 2137024..2137980 | - | 957 | WP_002356852 | ABC transporter permease subunit | - |
EF_RS10640 (EF2224) | 2138519..2143018 | - | 4500 | WP_011109527 | isopeptide-forming domain-containing fimbrial protein | - |
EF_RS10645 (EF2225) | 2143492..2144307 | - | 816 | WP_002383586 | MerR family transcriptional regulator | - |
EF_RS10650 (EF2226) | 2144374..2146101 | + | 1728 | WP_002359874 | ABC transporter ATP-binding protein | - |
EF_RS10655 (EF2227) | 2146154..2147932 | + | 1779 | WP_002374418 | ABC transporter ATP-binding protein | - |
EF_RS10660 (EF2228) | 2147986..2148990 | - | 1005 | WP_002379621 | tryptophan--tRNA ligase | - |
EF_RS10665 (EF2229) | 2149152..2152931 | - | 3780 | WP_002383585 | Ig-like domain-containing protein | - |
EF_RS10670 (EF2230) | 2152942..2153910 | - | 969 | WP_002383584 | hypothetical protein | - |
EF_RS10675 (EF2231) | 2154011..2154682 | - | 672 | WP_002383583 | hypothetical protein | - |
EF_RS10680 (EF2232) | 2154695..2155612 | - | 918 | WP_002383582 | carbohydrate ABC transporter permease | - |
EF_RS10685 (EF2233) | 2155585..2156487 | - | 903 | WP_002356840 | sugar ABC transporter permease | - |
EF_RS10690 (EF2234) | 2156638..2157915 | - | 1278 | WP_002359868 | sugar ABC transporter substrate-binding protein | - |
EF_RS10695 (EF2235) | 2157965..2159107 | - | 1143 | WP_002359867 | glycoside hydrolase family 88 protein | - |
EF_RS10700 (EF2236) | 2159123..2160922 | - | 1800 | WP_002359866 | DUF2264 domain-containing protein | - |
EF_RS10705 (EF2237) | 2160903..2161289 | - | 387 | WP_002359865 | membrane lipoprotein lipid attachment site-containing protein | - |
EF_RS10710 (EF2238) | 2161465..2162526 | + | 1062 | WP_002356832 | LacI family DNA-binding transcriptional regulator | - |
EF_RS10715 (EF2239) | 2162567..2163400 | - | 834 | WP_002369000 | hypothetical protein | - |
EF_RS10720 (EF2240) | 2163823..2164971 | - | 1149 | WP_002383579 | site-specific integrase | - |
EF_RS10725 (EF2241) | 2164977..2165162 | - | 186 | WP_002359862 | DUF3173 domain-containing protein | - |
EF_RS10730 (EF2243) | 2166261..2166452 | - | 192 | WP_002399806 | helix-turn-helix domain-containing protein | - |
EF_RS10735 (EF2244) | 2166531..2166989 | - | 459 | WP_002359860 | sigma-70 family RNA polymerase sigma factor | - |
EF_RS10740 (EF2245) | 2166991..2167452 | - | 462 | WP_002359859 | hypothetical protein | - |
EF_RS10745 (EF2247) | 2168130..2168864 | - | 735 | WP_002359858 | winged helix-turn-helix domain-containing protein | - |
EF_RS10750 (EF2248) | 2169108..2172122 | - | 3015 | WP_011109529 | BspA family leucine-rich repeat surface protein | - |
EF_RS10755 (EF2250) | 2172738..2174870 | - | 2133 | WP_010706530 | WxL domain-containing protein | - |
EF_RS10760 (EF2252) | 2174873..2175202 | - | 330 | WP_002383571 | LPXTG cell wall anchor domain-containing protein | - |
EF_RS10765 (EF2253) | 2175207..2176256 | - | 1050 | WP_002383570 | DUF916 and DUF3324 domain-containing protein | - |
EF_RS10770 (EF2254) | 2176313..2176981 | - | 669 | WP_002359849 | WxL domain-containing protein | - |
EF_RS10775 (EF2255) | 2177344..2178453 | - | 1110 | WP_002359848 | site-specific integrase | - |
EF_RS10780 (EF2257) | 2178943..2180244 | - | 1302 | WP_002359847 | PTS transporter subunit EIIC | - |
EF_RS10785 (EF2258) | 2180257..2180874 | - | 618 | WP_002387231 | hypothetical protein | - |
EF_RS10790 (EF2259) | 2180914..2181606 | + | 693 | WP_002383568 | SIS domain-containing protein | - |
EF_RS10795 (EF2260) | 2181852..2182409 | + | 558 | WP_002359842 | hypothetical protein | - |
EF_RS10800 (EF2262) | 2183317..2184111 | - | 795 | WP_002359839 | discoidin domain-containing protein | - |
EF_RS10805 (EF2263) | 2184206..2185009 | - | 804 | WP_002359838 | gluconate 5-dehydrogenase | - |
EF_RS10810 (EF2264) | 2185033..2185872 | - | 840 | WP_002383567 | 5-dehydro-4-deoxy-D-glucuronate isomerase | - |
EF_RS10815 (EF2265) | 2185899..2186900 | - | 1002 | WP_002383566 | sugar kinase | - |
EF_RS10820 (EF2266) | 2186903..2187550 | - | 648 | WP_002359835 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
EF_RS10825 (EF2267) | 2187628..2188044 | - | 417 | WP_010773786 | PTS sugar transporter subunit IIA | - |
EF_RS10830 (EF2268) | 2188057..2189985 | - | 1929 | WP_002359832 | alginate lyase family protein | - |
EF_RS10835 (EF2269) | 2190127..2190942 | - | 816 | WP_002359831 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EF_RS10840 (EF2270) | 2190932..2191747 | - | 816 | WP_002383564 | PTS sugar transporter subunit IIC | - |
EF_RS10845 (EF2271) | 2191777..2192277 | - | 501 | WP_002359829 | PTS sugar transporter subunit IIB | - |
EF_RS10850 (EF2272) | 2192295..2193482 | - | 1188 | WP_002359828 | glycoside hydrolase family 88 protein | - |
EF_RS10855 (EF2273) | 2193646..2194383 | - | 738 | WP_002359827 | GntR family transcriptional regulator | - |
EF_RS10860 (EF2276) | 2195165..2196838 | + | 1674 | WP_228841363 | FUSC family protein | - |
EF_RS10865 (EF2277) | 2197119..2198027 | - | 909 | WP_010706532 | conjugal transfer protein | - |
EF_RS10870 (EF2278) | 2198027..2199049 | - | 1023 | WP_002359823 | bifunctional lysozyme/C40 family peptidase | - |
EF_RS10875 (EF2279) | 2199046..2201160 | - | 2115 | WP_002383559 | FUSC family protein | - |
EF_RS10880 (EF2280) | 2201166..2203613 | - | 2448 | WP_002399809 | ATP-binding protein | - |
EF_RS10885 (EF2281) | 2203600..2203989 | - | 390 | WP_002359820 | conjugal transfer protein | - |
EF_RS10890 (EF2282) | 2204066..2204680 | + | 615 | WP_002359819 | hypothetical protein | - |
EF_RS10895 | 2204696..2204893 | + | 198 | Protein_2144 | hypothetical protein | - |
EF_RS10900 (EF2283) | 2204960..2206573 | - | 1614 | WP_002368663 | recombinase family protein | - |
EF_RS16605 (EF2284) | 2206701..2206877 | - | 177 | WP_002368665 | hypothetical protein | - |
EF_RS10905 (EF2285) | 2206945..2207805 | - | 861 | WP_002368666 | DUF6551 family protein | - |
EF_RS10910 (EF2286) | 2207802..2209013 | - | 1212 | WP_010773620 | ParB N-terminal domain-containing protein | - |
EF_RS10915 | 2209618..2209935 | - | 318 | WP_002368673 | HTH domain-containing protein | - |
EF_RS10920 (EF2289) | 2210145..2210591 | - | 447 | WP_002368676 | hypothetical protein | - |
EF_RS10925 (EF2290) | 2210747..2211127 | - | 381 | WP_002368678 | sigma-70 family RNA polymerase sigma factor | - |
EF_RS10930 (EF2291) | 2211601..2211966 | + | 366 | WP_002368681 | helix-turn-helix domain-containing protein | - |
EF_RS10935 (EF2293) | 2212353..2212961 | - | 609 | WP_002368685 | D-Ala-D-Ala dipeptidase VanX | - |
EF_RS10940 (EF2294) | 2212967..2213995 | - | 1029 | WP_002368691 | D-alanine--(R)-lactate ligase VanB | - |
EF_RS10945 (EF2295) | 2213988..2214959 | - | 972 | WP_002368693 | D-lactate dehydrogenase VanH | - |
EF_RS10950 (EF2296) | 2214956..2215783 | - | 828 | WP_002368694 | glycopeptide resistance accessory protein VanW-B | - |
EF_RS10955 (EF2297) | 2215801..2216607 | - | 807 | WP_002368695 | D-Ala-D-Ala carboxypeptidase VanY-B | - |
EF_RS10960 (EF2298) | 2216783..2218126 | - | 1344 | WP_002368696 | vancomycin resistance histidine kinase VanS-B | - |
EF_RS10965 (EF2299) | 2218126..2218788 | - | 663 | WP_002368697 | vancomycin resistance response regulator transcription factor VanR-B | - |
EF_RS16830 | 2218921..2219031 | - | 111 | Protein_2160 | aminoglycoside 6-adenylyltransferase | - |
EF_RS10975 (EF2302) | 2219565..2219753 | - | 189 | WP_025186763 | SymE family type I addiction module toxin | - |
EF_RS10980 | 2219735..2219923 | - | 189 | WP_002368701 | hypothetical protein | - |
EF_RS10985 (EF2303) | 2220066..2221478 | - | 1413 | WP_002368703 | relaxase/mobilization nuclease domain-containing protein | - |
EF_RS10990 (EF2304) | 2221592..2221834 | + | 243 | WP_002368704 | helix-turn-helix transcriptional regulator | - |
EF_RS10995 (EF2305) | 2221837..2222787 | - | 951 | WP_002368706 | DUF3991 and toprim domain-containing protein | - |
EF_RS11000 (EF2306) | 2222854..2223168 | - | 315 | WP_229207000 | plasmid mobilization relaxosome protein MobC | - |
EF_RS11005 (EF2307) | 2223189..2232710 | - | 9522 | WP_010774229 | DEAD/DEAH box helicase family protein | - |
EF_RS11010 | 2232905..2233192 | - | 288 | WP_244264353 | hypothetical protein | - |
EF_RS11015 | 2233266..2233541 | - | 276 | WP_002368711 | hypothetical protein | - |
EF_RS11020 (EF2310) | 2233538..2233987 | - | 450 | WP_010773623 | DUF4316 domain-containing protein | - |
EF_RS16835 (EF2311) | 2233984..2234145 | - | 162 | WP_011109534 | hypothetical protein | - |
EF_RS16840 | 2234133..2234369 | - | 237 | WP_244264354 | helix-turn-helix domain-containing protein | - |
EF_RS11030 (EF2312) | 2234375..2236492 | - | 2118 | WP_002368714 | DNA topoisomerase 3 | - |
EF_RS11035 | 2236670..2238907 | - | 2238 | WP_002368715 | DUF4366 domain-containing protein | - |
EF_RS11040 (EF2315) | 2238911..2239159 | - | 249 | WP_002368716 | DUF4315 family protein | - |
EF_RS11045 (EF2316) | 2239156..2240058 | - | 903 | WP_002368717 | radical SAM protein | - |
EF_RS11050 (EF2318) | 2240101..2242878 | - | 2778 | WP_010773625 | CD1108 family mobile element protein | cd419a |
EF_RS11055 (EF2319) | 2242875..2243990 | - | 1116 | WP_010773626 | DUF6674 family protein | - |
EF_RS11060 (EF2320) | 2244004..2246481 | - | 2478 | WP_010773627 | VirB4-like conjugal transfer ATPase, CD1110 family | virb4 |
EF_RS11065 (EF2321) | 2246405..2246824 | - | 420 | WP_002368721 | PrgI family protein | prgIa |
EF_RS11070 (EF2322) | 2246825..2248129 | - | 1305 | WP_010773628 | DUF3848 domain-containing protein | - |
EF_RS11075 (EF2323) | 2248148..2248712 | - | 565 | Protein_2182 | MT-A70 family methyltransferase | - |
EF_RS11080 (EF2324) | 2248728..2249597 | - | 870 | WP_002368724 | VirB6/TrbL-like conjugal transfer protein, CD1112 family | prgHa |
EF_RS11085 | 2249611..2249709 | - | 99 | Protein_2184 | Maff2 family protein | - |
EF_RS11090 (EF2326) | 2249859..2251745 | - | 1887 | WP_011109539 | group II intron reverse transcriptase/maturase | - |
EF_RS11095 (EF2327) | 2252468..2252596 | - | 129 | Protein_2186 | Maff2 family protein | - |
EF_RS11100 (EF2328) | 2252661..2254436 | - | 1776 | WP_002368726 | VirD4-like conjugal transfer protein, CD1115 family | - |
EF_RS11105 (EF2329) | 2254433..2254912 | - | 480 | WP_002368727 | PcfB family protein | cd411 |
EF_RS11110 (EF2330) | 2254941..2255447 | - | 507 | WP_002368728 | hypothetical protein | - |
EF_RS11115 (EF2331) | 2255485..2255916 | - | 432 | WP_002368729 | hypothetical protein | - |
EF_RS11120 (EF2332) | 2255995..2256822 | - | 828 | WP_010773630 | phosphoadenosine phosphosulfate reductase family protein | - |
EF_RS11125 (EF2333) | 2256825..2257283 | - | 459 | WP_002368731 | DUF3846 domain-containing protein | - |
EF_RS11130 (EF2334) | 2257334..2258320 | - | 987 | WP_002368732 | DUF6017 domain-containing protein | - |
EF_RS16845 | 2258580..2258963 | + | 384 | Protein_2194 | hypothetical protein | - |
EF_RS11140 (EF2335) | 2258996..2259496 | - | 501 | WP_002359817 | antirestriction protein ArdA | - |
EF_RS11145 (EF2336) | 2259509..2259730 | - | 222 | WP_002298822 | hypothetical protein | orf19 |
EF_RS11150 (EF2337) | 2259735..2259872 | - | 138 | WP_002359816 | DUF3789 domain-containing protein | - |
EF_RS11155 (EF2338) | 2259869..2261053 | - | 1185 | WP_002359815 | MobT family relaxase | - |
EF_RS11160 (EF2339) | 2261311..2261565 | - | 255 | WP_002359814 | hypothetical protein | - |
EF_RS11165 (EF2340) | 2261591..2262733 | - | 1143 | WP_002387062 | DNA (cytosine-5-)-methyltransferase | - |
EF_RS11170 (EF2341) | 2262814..2263635 | - | 822 | WP_002359810 | hypothetical protein | - |
EF_RS11175 (EF2342) | 2263625..2264083 | - | 459 | WP_002359809 | hypothetical protein | - |
EF_RS11180 (EF2343) | 2264189..2265535 | - | 1347 | WP_002399949 | FtsK/SpoIIIE domain-containing protein | virb4 |
EF_RS11185 (EF2344) | 2265603..2265947 | - | 345 | WP_002359807 | hypothetical protein | - |
EF_RS11190 (EF2345) | 2265957..2266328 | - | 372 | WP_002359806 | YdcP family protein | orf23 |
EF_RS11195 (EF2346) | 2266341..2266655 | - | 315 | WP_002383555 | YdcP family protein | orf23 |
EF_RS11200 (EF2347) | 2266768..2269992 | - | 3225 | WP_010774232 | fibrinogen-binding MSCRAMM adhesin Fss3 | - |
EF_RS11205 (EF2348) | 2270275..2272107 | - | 1833 | WP_002387067 | ATP-binding protein | virb4 |
EF_RS11210 (EF2349) | 2272094..2273473 | - | 1380 | WP_002383549 | SIR2 family protein | - |
EF_RS11215 (EF2350) | 2273574..2274503 | - | 930 | WP_002359794 | helix-turn-helix transcriptional regulator | - |
EF_RS11220 (EF2352) | 2274702..2276537 | - | 1836 | WP_010706535 | translation elongation factor 4 | - |
Host bacterium
ID | 269 | Element type | ICE (Integrative and conjugative element) |
Element name | ICE_EfalV583_lepA | GenBank | NC_004668 |
Element size | 3218031 bp | Coordinate of oriT [Strand] | 97367..97409 [+] |
Host bacterium | Enterococcus faecalis V583 | Coordinate of element | 2163705..2274732 |
Cargo genes
Drug resistance gene | VanHBX |
Virulence gene | fss3 |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIIA21 |