Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200298 |
| Name | oriT_ICE_Cdi630_guaA |
| Organism | Clostridioides difficile 630 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NC_009089 (_) |
| oriT length | 126 nt |
| IRs (inverted repeats) | 101..107, 120..126 (TGTCAAC..GTTGACA) 61..66, 78..83 (AATCCC..GGGATT) 2..8, 19..25 (ACCCCTC..GAGGGGT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 126 nt
>oriT_ICE_Cdi630_guaA
AACCCCTCGTATCTAACAGAGGGGTACAAATCGACAGGTAACAACCAAACAACAGGGCAGAATCCCACGGTACACAAGGGATTTTCCCATATCCGGCGTGTGTCAACAAGGCTCTGAAAGTTGACA
AACCCCTCGTATCTAACAGAGGGGTACAAATCGACAGGTAACAACCAAACAACAGGGCAGAATCCCACGGTACACAAGGGATTTTCCCATATCCGGCGTGTGTCAACAAGGCTCTGAAAGTTGACA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 14335 | GenBank | WP_032506928 |
| Name | mobT_CD630_RS17765_ICE_Cdi630_guaA |
UniProt ID | _ |
| Length | 403 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 403 a.a. Molecular weight: 47872.61 Da Isoelectric Point: 6.2843
>WP_032506928.1 MULTISPECIES: MobT family relaxase [Clostridia]
MRFFRQEGFSLNEETWVRDIKEKREIYGISQQKLALAAGITRPYLSDIETGKAHPSEALQEAITEALERF
NPDAPLEMLFDYVRIRFPTTDVKHIVEDVLRLKLSYFIHEDYGFYSYTEHYYLGDIFVLVSPELEKGVLL
ELKGRGCRQFESYLLAQERSWYEFFMDVLMEDGVMKRLDLAINDKTGILNIPHLTEKCRNEECISVFRSF
KSYRSGELVRREEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKHDIPIADAEVKNRFEIRLKNERAFYA
IRDLLEHDNPERTAFQIINRYVRFVDRDDTKPRSDWRISEEWEWFIGEHRGSLKLTTKPEPYSFERTLHW
LSHQVAPTLKLALRLDKMNHTQIVHDIITHARLTEKHEKILKQQAAAAKEVVL
MRFFRQEGFSLNEETWVRDIKEKREIYGISQQKLALAAGITRPYLSDIETGKAHPSEALQEAITEALERF
NPDAPLEMLFDYVRIRFPTTDVKHIVEDVLRLKLSYFIHEDYGFYSYTEHYYLGDIFVLVSPELEKGVLL
ELKGRGCRQFESYLLAQERSWYEFFMDVLMEDGVMKRLDLAINDKTGILNIPHLTEKCRNEECISVFRSF
KSYRSGELVRREEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKHDIPIADAEVKNRFEIRLKNERAFYA
IRDLLEHDNPERTAFQIINRYVRFVDRDDTKPRSDWRISEEWEWFIGEHRGSLKLTTKPEPYSFERTLHW
LSHQVAPTLKLALRLDKMNHTQIVHDIITHARLTEKHEKILKQQAAAAKEVVL
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4CP
| ID | 16827 | GenBank | WP_011861922 |
| Name | tcpA_CD630_RS17770_ICE_Cdi630_guaA |
UniProt ID | _ |
| Length | 465 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 465 a.a. Molecular weight: 53978.86 Da Isoelectric Point: 7.3405
>WP_011861922.1 MULTISPECIES: FtsK/SpoIIIE domain-containing protein [Clostridia]
MKQLFPRGKRIRPTDKDLMFHTALAALFPVFLLVVLLFHIRQIAGTNWQEVSLSQITQDVNIPYLLFSIG
MAGMVCLIAVLLFWRYRRDEVKQLIHRQKLARMVLENKWYESEQRKEDAFFKDLSSSRSKETITYFPKIY
YRMKQGLLHIRVEITLGKYQEQLLNLERKLESGLYCELTDKELKDSYVEYTLLYDTIANRISIEDVQAKD
GRLRLMENVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLRTNAVLFVLDPKNADLADLQAVMPDVYYK
KEDMLACIDRFYEEMMKRSEDMKLMENYRTGENYAYLGLPANFLIFDEYVAFMEMLGTKENAAVLNKLKQ
IVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGETTKDFFLKQIKGRGYVDV
GTSVISEFYTPLVPKGHDFLKEIKKLTDSRQGVQAACEAEAAETD
MKQLFPRGKRIRPTDKDLMFHTALAALFPVFLLVVLLFHIRQIAGTNWQEVSLSQITQDVNIPYLLFSIG
MAGMVCLIAVLLFWRYRRDEVKQLIHRQKLARMVLENKWYESEQRKEDAFFKDLSSSRSKETITYFPKIY
YRMKQGLLHIRVEITLGKYQEQLLNLERKLESGLYCELTDKELKDSYVEYTLLYDTIANRISIEDVQAKD
GRLRLMENVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLRTNAVLFVLDPKNADLADLQAVMPDVYYK
KEDMLACIDRFYEEMMKRSEDMKLMENYRTGENYAYLGLPANFLIFDEYVAFMEMLGTKENAAVLNKLKQ
IVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGETTKDFFLKQIKGRGYVDV
GTSVISEFYTPLVPKGHDFLKEIKKLTDSRQGVQAACEAEAAETD
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 585695..599749
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS03005 (CD630_04910) | 581646..582062 | + | 417 | WP_003434797 | PTS sugar transporter subunit IIA | - |
| CD630_RS03010 (CD630_04920) | 582091..582564 | + | 474 | WP_003426364 | PTS sugar transporter subunit IIB | - |
| CD630_RS03015 (CD630_04930) | 582611..583369 | + | 759 | WP_003434801 | PTS sugar transporter subunit IIC | - |
| CD630_RS03020 (CD630_04940) | 583393..584232 | + | 840 | WP_011860838 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| CD630_RS03025 | 584769..585425 | + | 657 | WP_022621482 | Fic family protein | - |
| CD630_RS03030 (CD630_04960) | 585695..586009 | + | 315 | WP_002324559 | YdcP family protein | orf23 |
| CD630_RS03035 (CD630_04970) | 586031..586417 | + | 387 | WP_002324558 | YdcP family protein | orf23 |
| CD630_RS03040 (CD630_04980) | 586451..587836 | + | 1386 | WP_002324557 | FtsK/SpoIIIE domain-containing protein | virb4 |
| CD630_RS03045 (CD630_04981) | 587839..587991 | + | 153 | WP_011860839 | hypothetical protein | - |
| CD630_RS03050 (CD630_04990) | 588013..589218 | + | 1206 | WP_025186485 | MobT family relaxase | - |
| CD630_RS03055 (CD630_04991) | 589261..589482 | + | 222 | WP_001009056 | hypothetical protein | orf19 |
| CD630_RS03060 (CD630_05000) | 589599..590096 | + | 498 | WP_002324555 | antirestriction protein ArdA | - |
| CD630_RS03065 (CD630_05010) | 590184..590576 | + | 393 | WP_002324554 | conjugal transfer protein | orf17a |
| CD630_RS03070 (CD630_05020) | 590560..593007 | + | 2448 | WP_002324553 | ATP-binding protein | virb4 |
| CD630_RS03075 (CD630_05030) | 593064..595175 | + | 2112 | WP_231300444 | YtxH domain-containing protein | orf15 |
| CD630_RS03080 (CD630_05040) | 595172..596116 | + | 945 | WP_022621483 | bifunctional lysozyme/C40 family peptidase | orf14 |
| CD630_RS03085 (CD630_05060) | 596830..598659 | + | 1830 | WP_002335621 | group II intron reverse transcriptase/maturase | - |
| CD630_RS03095 (CD630_05070) | 598817..599749 | + | 933 | WP_002324550 | conjugal transfer protein | orf13 |
| CD630_RS03105 (CD630_05080) | 600034..601953 | + | 1920 | WP_011860841 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| CD630_RS03110 (CD630_05081) | 602076..602243 | + | 168 | WP_002319681 | cysteine-rich KTR domain-containing protein | - |
| CD630_RS03115 (CD630_05090) | 602302..602655 | - | 354 | WP_002324548 | helix-turn-helix domain-containing protein | - |
| CD630_RS03120 (CD630_05100) | 603157..603582 | + | 426 | WP_002324547 | sigma-70 family RNA polymerase sigma factor | - |
| CD630_RS03125 (CD630_05101) | 603579..603809 | + | 231 | WP_002334012 | helix-turn-helix domain-containing protein | - |
| CD630_RS19655 (CD630_05103) | 604190..604330 | + | 141 | WP_002324545 | hypothetical protein | - |
Region 2: 3897502..3910292
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CD630_RS17675 (CD630_33280) | 3892914..3893153 | - | 240 | WP_009009556 | helix-turn-helix domain-containing protein | - |
| CD630_RS17680 (CD630_33290) | 3893150..3893569 | - | 420 | WP_020994407 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| CD630_RS17685 (CD630_33300) | 3894170..3894526 | + | 357 | WP_009009558 | helix-turn-helix domain-containing protein | - |
| CD630_RS17690 (CD630_33310) | 3894559..3895254 | - | 696 | WP_011861910 | transposase | - |
| CD630_RS17695 (CD630_33320) | 3895434..3896003 | + | 570 | WP_011861911 | TetR/AcrR family transcriptional regulator | - |
| CD630_RS17700 (CD630_33330) | 3896000..3896260 | + | 261 | WP_094030748 | competence protein TfoX | - |
| CD630_RS17705 (CD630_33331) | 3896491..3896733 | + | 243 | WP_011861913 | DUF3781 domain-containing protein | - |
| CD630_RS17710 (CD630_33340) | 3896730..3897200 | + | 471 | WP_011861914 | GyrI-like domain-containing protein | - |
| CD630_RS17715 (CD630_33350) | 3897502..3898410 | - | 909 | WP_011861915 | conjugal transfer protein | orf13 |
| CD630_RS17720 (CD630_33360) | 3898427..3899431 | - | 1005 | WP_011861916 | bifunctional lysozyme/C40 family peptidase | orf14 |
| CD630_RS20415 (CD630_33370) | 3899428..3901809 | - | 2382 | WP_011861917 | membrane protein | orf15 |
| CD630_RS17730 (CD630_33380) | 3901806..3904259 | - | 2454 | WP_011861918 | ATP-binding protein | virb4 |
| CD630_RS17735 (CD630_33390) | 3904243..3904635 | - | 393 | WP_005427021 | conjugal transfer protein | orf17a |
| CD630_RS17740 (CD630_33400) | 3904725..3905222 | - | 498 | WP_011861919 | antirestriction protein ArdA | - |
| CD630_RS20085 | 3905239..3905511 | - | 273 | WP_231300324 | antirestriction protein ArdA | - |
| CD630_RS17750 | 3905666..3905809 | + | 144 | WP_022621533 | hypothetical protein | - |
| CD630_RS17755 (CD630_33420) | 3905806..3906312 | - | 507 | WP_011861920 | superinfection exclusion B family protein | - |
| CD630_RS17760 (CD630_33421) | 3906498..3906719 | - | 222 | WP_002570387 | hypothetical protein | orf19 |
| CD630_RS17765 (CD630_33430) | 3906771..3907982 | - | 1212 | WP_032506928 | MobT family relaxase | - |
| CD630_RS17770 (CD630_33440) | 3908146..3909543 | - | 1398 | WP_011861922 | FtsK/SpoIIIE domain-containing protein | virb4 |
| CD630_RS17775 (CD630_33450) | 3909579..3909956 | - | 378 | WP_011861923 | YdcP family protein | orf23 |
| CD630_RS17780 (CD630_33460) | 3909978..3910292 | - | 315 | WP_002578441 | YdcP family protein | orf23 |
| CD630_RS17785 (CD630_33470) | 3910549..3911223 | + | 675 | WP_011861924 | hypothetical protein | - |
| CD630_RS17790 (CD630_33480) | 3911224..3912117 | + | 894 | WP_011861925 | MBL fold metallo-hydrolase | - |
| CD630_RS17795 (CD630_33490) | 3912316..3914301 | - | 1986 | WP_011861926 | collagen-like exosporium glycoprotein BclA3 | - |
Host bacterium
| ID | 268 | Element type | ICE (Integrative and conjugative element) |
| Element name | ICE_Cdi630_fic | GenBank | NC_009089 |
| Element size | 4290252 bp | Coordinate of oriT [Strand] | 2494..2626 [+] |
| Host bacterium | Clostridioides difficile 630 | Coordinate of element | 585378..606047 |
Cargo genes
| Drug resistance gene | tet(M) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |